KEGG   Bacillus amyloliquefaciens LL3: LL3_04167Help
Entry
LL3_04167         CDS       T01835                                 

Gene name
argI
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bql01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bql00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3919182..3920006)
Genome map
AA seq 274 aa AA seqDB search
MGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKKDEELKNLNSVLSGNEQLAQKVDS
VIESERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYDAHGDLNTLETSPSGNIHGMPLA
VSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGEREYIKETGMKVYTMHEIDRLGMT
RVMEETIDYLSGCDGVHLSLDLDGLDPSDAPGVGTPVVGGISYRESHLAMEMLYDADIIT
SAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatggggtat
gcggtggaagacctgggcgacatccccgtcaatcgtgaaaaactcaaaaaagatgaagag
ctgaaaaatctgaactctgtgctctcaggtaacgagcagctcgcccaaaaggtggacagc
gtcattgagagtgagcggttccctctcgtcctgggcggcgatcacagcatcgcgatcgga
acgctgacaggaacggccaagcactataaacagctcggtgttatctggtacgacgcgcac
ggcgacttaaacacgctggaaacatcgccgtcaggcaatattcacggaatgccgctggcc
gtcagcctcggcgtcggccacgacacattggtgaatctgggcggctatgccccgaaaatc
aagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggcgagcgtgaatac
attaaggaaacaggcatgaaggtatatacgatgcatgagattgaccgcctcggcatgacg
agggtcatggaagaaaccattgactacctgtcaggctgtgacggcgttcatctcagcctt
gatctcgacggccttgatccgagtgacgcgcccggcgtagggacgcctgtcgtcggcggc
atcagctaccgtgaaagccatttggcaatggaaatgctgtatgatgccgacattatcacc
tcagctgaatttgttgaagtcaatccgatcctcgatcacaaaaacaaaaccggcaaaaca
gcggttgagctggtggagtccttgttaggaaaaaaactattataa

DBGET integrated database retrieval system