KEGG   Bartonella quintana RM-11: RM11_0138Help
Entry
RM11_0138         CDS       T02294                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00330  Arginine and proline metabolism
bqr00332  Carbapenem biosynthesis
bqr01100  Metabolic pathways
bqr01130  Biosynthesis of antibiotics
bqr01230  Biosynthesis of amino acids
Module
bqr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RM11_0138
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RM11_0138
Enzymes [BR:bqr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RM11_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 13564264
NCBI-ProteinID: AFR25881
Position
192837..193964
Genome map
AA seq 375 aa AA seqDB search
MQKLAHYKRIVVKIGSALLVEPQTGLRAEWLKSLINDVAKLHQKGVEILLVSSGAIALGR
TLLRLPRGVLKLEESQACAALGQIELAKTYGDALAQYGLKTGQILLTLLDTEERRRYLNA
RATINVLLRFGAVPVINENDTVATSEIRYGDNDRLAARVATMMGADLLILLSDIDGLYTK
SPHRDPTAEFIPFITSITSDIEKMADVAASELSRGGMKTKLDAGKIANSAGTAMVITSGK
RMNPLAAIDRGERRSFFAASEKPVNAWKTWISGHLGPSGILTIDPGAAKALESGKSLLAA
GVIAVDGMFHRGDTVAIVDTKGVEIARGLVSYGKNEAVRIMGRKREEIESILGYEARSAM
VHRNDMVLRCLTDSA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaacttgcgcactataaacgtattgtggtaaaaattggatctgcgcttttggtt
gagcctcagacaggtttacgagctgaatggcttaaaagtttgataaatgatgttgccaag
ttgcatcaaaaaggcgttgagattttattagtgtcttcaggggctattgccttagggaga
acgttgctccgtcttcctagaggtgttttgaaattggaagaaagtcaggcatgtgctgct
ttggggcaaattgaattagcaaaaacctatggtgatgcgcttgctcaatatggattaaaa
actggtcagattttgctcactctattggatacggaagagcgacggcgttatctcaatgcg
cgtgctacgattaatgtgcttttacgttttggagcagtgcctgttattaatgagaatgat
actgttgcaacaagtgaaattcgttatggtgataatgatcgtttagcagcccgtgtggcg
acgatgatgggtgcggatcttttaatacttttatcagatattgatggtctttatacgaag
tctcctcatcgtgatccaacagctgaatttattccttttattacatcaattacaagtgat
atcgaaaaaatggcagacgttgctgcttcagagctttcacggggaggaatgaagactaag
cttgatgccggaaaaatagcaaattctgctggaacagcaatggttattacttcaggcaag
cgcatgaatcctcttgcagcgattgatagaggggaacgcagaagtttttttgctgccagt
gaaaagcctgttaatgcttggaaaacatggatttctggtcatttaggtccgtctggtatt
ttaacgattgatccgggagcagctaaggctcttgaatcaggaaaatccttattagctgca
ggagttatagcggttgatgggatgtttcatcgtggagatacggttgcaattgttgataca
aagggcgttgagattgctcgtgggcttgtgagttatggcaaaaatgaagctgtacgcatt
atggggcgtaaaagagaagaaatcgagtctattcttgggtatgaagcgcgttctgctatg
gtgcatcgtaatgatatggttttacgctgcttgaccgattctgcttaa

DBGET integrated database retrieval system