KEGG   Bartonella quintana RM-11: RM11_0154Help
Entry
RM11_0154         CDS       T02294                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bqr  Bartonella quintana RM-11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bqr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bqr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bqr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bqr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211975..212895
Genome map
AA seq 306 aa AA seqDB search
MLYGKSGGVKVRKIRKAVFPVAGLGTRFLPATKTIPKEMLTVVDKPVIQYVVDEAREAGI
EHFIFVTGRNKVVLEDYFDVQVELYTILAERGKREELEHLHGLQPPPGTTSFTRQQQPLG
LGHALWCARELVEGEPFALLLPDMLMQAKKGCLSEMINLYEKTGGGNIIAVQECDPAQAH
KYGIVGKGKQIANGFEITKMVEKPTKGTAPSNLYINGRYILQPEIFNILSNQERGAENEI
QLTDAMMRLSNEQDFFGFQLEGRTFDCGSKAGFIEANVAFSLARADMHSQISASLKNLLE
TIKVGK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctatacggtaaatcaggaggggtaaaagtgcgtaaaattcggaaagcagtatttcct
gtagctggtcttggtacacgttttcttcctgcaacaaaaacaattcctaaagaaatgcta
actgttgttgataagcccgttattcaatatgttgtagatgaagcacgtgaagctggtatt
gaacattttatttttgttactgggcgtaataaagtagtccttgaggattattttgatgtg
caagttgaattatatacaatccttgccgaacgtggcaaaagagaagaacttgagcattta
cacggtttacaacctccaccagggacgacttcttttacgcggcaacagcaacctttgggg
ctaggacatgctctttggtgcgcacgtgaattagttgagggggaaccttttgctttgttg
ttacccgatatgctgatgcaagctaaaaaggggtgcctttctgagatgattaatctttat
gagaaaaccggtggtggcaatattatcgccgttcaggagtgcgatcctgcacaagcgcat
aaatatggtattgttggaaaaggcaaacagattgcaaatggttttgaaatcacaaaaatg
gtagaaaaaccaacaaaaggaacagctccatcgaatttgtacatcaatggacgttatatc
ttgcaaccagaaatttttaatattctctccaatcaagaacgaggagcagaaaacgaaatt
cagttaacagatgcaatgatgcggctttcaaatgagcaagatttctttggcttccagtta
gaggggcgcacttttgattgtggttcaaaagccggttttattgaagccaatgttgcattt
tctttagcacgcgctgatatgcatagccaaatttctgcttcattgaaaaatttactagaa
accattaaagtgggaaaatga

DBGET integrated database retrieval system