KEGG   Bartonella quintana RM-11: RM11_0207Help
Entry
RM11_0207         CDS       T02294                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bqr  Bartonella quintana RM-11
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RM11_0207
DNA repair and recombination proteins [BR:bqr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RM11_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(276273..276878)
Genome map
AA seq 201 aa AA seqDB search
MSKHIAGPEIERLIQLLARIPGFGPRSARRAALYLIKKRETLLEPLGAAIQAAVDKVCIC
SVCGNVDTTDPCSICRDPRRDDTTIIVVEDVADLWALERARTLAARYHVLGGRLSPLDGI
GPDELNITSLVQRVVQNPIMEIILAVNATVEGQTTAHYITDQLSNFSVKITRLAHGVPVG
GELDYLDDGTLAAALQARTNL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcacattgcaggacctgagattgagcgcctcattcagcttttagcgcggata
ccaggttttggtccgcgttcagcgcgtcgtgctgcactttaccttatcaaaaaaagggag
acattgctggagcccttaggagcagctatacaagcagctgtagataaagtctgcatttgt
tctgtttgtggaaatgtcgataccactgatccttgttcgatttgtagagatcctcgccgc
gatgatacaacaattattgttgttgaagatgttgctgatctctgggctcttgagcgtgcg
agaactttggcagcccgttatcatgtcttaggcggacggctctcaccattagatggaata
ggacctgatgaactcaacatcacttccttagttcagcgcgttgtacagaatccaattatg
gagattattctagctgttaatgctacggttgaaggacaaacaacagctcactacatcacg
gatcagctctccaatttttcagttaaaattacgcgacttgcccatggagtacccgtagga
ggtgaactagattatcttgatgatggaaccttggctgcagccttacaggcaagaacaaat
ctttaa

DBGET integrated database retrieval system