KEGG   Bartonella quintana RM-11: RM11_0212Help
Entry
RM11_0212         CDS       T02294                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bqr  Bartonella quintana RM-11
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bqr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bqr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283047..283586
Genome map
AA seq 179 aa AA seqDB search
MNRSTVAYFIFACLFLLIILVGISTLSNMVYDHSALVQPAYKVTKSDVLKKKQLTSDISL
SLNDRLQQGNLENGRKIFRQCALCHTSRQNEVGRVGPALWGVVDRPLAATTGFAYSRVLR
ANSDKRWDFVTLDRYLQSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSDHPVSLPMR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttcgacagttgcctattttatttttgcttgtctatttttgctgattattttg
gtgggaatttctacactcagcaacatggtttatgatcactctgcattggttcaacctgct
tataaggttacaaaaagtgatgtgctcaagaaaaaacagctgacatctgatatttctttg
tcattgaacgatcgtcttcaacaaggaaatcttgaaaatgggcgtaagatttttcgtcag
tgtgctctctgccatacctcgagacagaatgaagttggccgtgttggtccagcactttgg
ggggtagttgaccgtcctttggcggctacaacaggttttgcttattcacgtgtactgcgt
gcaaattctgataagagatgggattttgtgactttggatcgttatctgcaatctccacgt
gaagcgtttccaggaacaattatgtcttttcgtggaattaaaaatgatcaagatcgtgct
gatcttttgctttatttacgcagtttgtccgatcatcctgtttctttgccgatgcgataa

DBGET integrated database retrieval system