KEGG   Bartonella quintana RM-11: RM11_0303Help
Entry
RM11_0303         CDS       T02294                                 

Definition
(GenBank) isopentenyl monophosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00900  Terpenoid backbone biosynthesis
bqr01100  Metabolic pathways
bqr01110  Biosynthesis of secondary metabolites
bqr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RM11_0303
Enzymes [BR:bqr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RM11_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 13563178
NCBI-ProteinID: AFR26043
Position
399674..400510
Genome map
AA seq 278 aa AA seqDB search
MHVVGQRTDGYHLIESLVYFSLSGDCLSYMPCKSNHFILTGPFADELVSDTGNLVVRAHD
FMCKAFPKCAKPAFFRLVKLLPVASGIGGGSGNAAGVLSLLRQQWGLDCSCEKLAEMSLV
LGADVPMCLFALEYQQPLFVRGIGQDITQLKEACSLAMVLVNHGQQIATKAVFKALEKRD
RPPVKIDLESLKTVDSLVEALQETRNDLFIPALKIAPQLSEVLYALDESGALFSRMSGTG
ATCFGIFKDKEAAQQAALFIKLMHPDWFVKPIITLGML
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgttgtagggcagcgcacggatggttatcatttaatagaaagtttggtttatttt
agtctcagcggtgattgtttgagctatatgccttgtaagagtaatcactttattttaaca
gggccttttgccgatgagcttgtttctgatacaggtaatttggttgttcgtgcacatgac
tttatgtgtaaggcctttcctaagtgtgccaaacctgctttttttcgacttgttaaacta
ttgccggttgcttcggggattggtggtggttcgggcaatgctgctggtgttttgagtcta
ttgcgtcagcagtggggtcttgattgctcttgtgaaaaattggcggaaatgagcttagtg
cttggtgctgatgtgccgatgtgtctttttgcattggagtatcagcagccactttttgtt
agaggaattgggcaagatataacacagttaaaagaggcttgttctcttgcaatggttttg
gttaatcatggacaacagattgcgacgaaagctgtttttaaggctttggagaagcgcgat
cgtccacccgtaaagattgatctagaatctctcaagacggttgattcattggttgaagct
ttacaagaaacacgtaacgatctttttattcccgcattaaaaattgcacctcaattgtct
gaagttttatatgccttagatgagagtggagctctcttttctcgtatgtccgggactggt
gcaacttgttttggtatttttaaagataaagaagcagcacagcaggctgctctttttatc
aaattgatgcatccagattggtttgttaaacctatcataactttaggaatgctttag

DBGET integrated database retrieval system