KEGG   Bartonella quintana RM-11: RM11_0303Help
Entry
RM11_0303         CDS       T02294                                 

Definition
isopentenyl monophosphate kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bqr  Bartonella quintana RM-11
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RM11_0303
Enzymes [BR:bqr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RM11_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399674..400510
Genome map
AA seq 278 aa AA seqDB search
MHVVGQRTDGYHLIESLVYFSLSGDCLSYMPCKSNHFILTGPFADELVSDTGNLVVRAHD
FMCKAFPKCAKPAFFRLVKLLPVASGIGGGSGNAAGVLSLLRQQWGLDCSCEKLAEMSLV
LGADVPMCLFALEYQQPLFVRGIGQDITQLKEACSLAMVLVNHGQQIATKAVFKALEKRD
RPPVKIDLESLKTVDSLVEALQETRNDLFIPALKIAPQLSEVLYALDESGALFSRMSGTG
ATCFGIFKDKEAAQQAALFIKLMHPDWFVKPIITLGML
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgttgtagggcagcgcacggatggttatcatttaatagaaagtttggtttatttt
agtctcagcggtgattgtttgagctatatgccttgtaagagtaatcactttattttaaca
gggccttttgccgatgagcttgtttctgatacaggtaatttggttgttcgtgcacatgac
tttatgtgtaaggcctttcctaagtgtgccaaacctgctttttttcgacttgttaaacta
ttgccggttgcttcggggattggtggtggttcgggcaatgctgctggtgttttgagtcta
ttgcgtcagcagtggggtcttgattgctcttgtgaaaaattggcggaaatgagcttagtg
cttggtgctgatgtgccgatgtgtctttttgcattggagtatcagcagccactttttgtt
agaggaattgggcaagatataacacagttaaaagaggcttgttctcttgcaatggttttg
gttaatcatggacaacagattgcgacgaaagctgtttttaaggctttggagaagcgcgat
cgtccacccgtaaagattgatctagaatctctcaagacggttgattcattggttgaagct
ttacaagaaacacgtaacgatctttttattcccgcattaaaaattgcacctcaattgtct
gaagttttatatgccttagatgagagtggagctctcttttctcgtatgtccgggactggt
gcaacttgttttggtatttttaaagataaagaagcagcacagcaggctgctctttttatc
aaattgatgcatccagattggtttgttaaacctatcataactttaggaatgctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system