KEGG   Bartonella quintana RM-11: RM11_0456Help
Entry
RM11_0456         CDS       T02294                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bqr  Bartonella quintana RM-11
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RM11_0456
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RM11_0456
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RM11_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579120..579407
Genome map
AA seq 95 aa AA seqDB search
MLPLPSLTLVAHYPSAVLWGKLIKKIKIREFVLHGLCLDFMLFDLMKFGINANFLPVLDV
PDGAHDIIGTRAYGQEQETVVALGCAAAAQGLVLG
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
ttgcttccacttccatctctaactctagtagctcattatccatcagctgtactttgggga
aagcttataaaaaagattaagataagggaatttgtactgcatggattatgtctcgacttt
atgctttttgatttaatgaaatttggcatcaatgccaattttcttcctgttttagatgtt
ccagatggagcgcacgatattattggaacacgtgcttatggtcaggaacaagaaacagtt
gtagctttagggtgtgcagcagcagcccaggggttggttttgggatag

DBGET integrated database retrieval system