KEGG   Bartonella quintana RM-11: RM11_0462Help
Entry
RM11_0462         CDS       T02294                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bqr  Bartonella quintana RM-11
Brite
Enzymes [BR:bqr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RM11_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F Methyltransf_11 MTS Methyltransf_23 RrnaAD Methyltransf_4 GCD14 NodS Methyltransf_3 DREV
Motif
Other DBs
NCBI-GeneID: 13563336
NCBI-ProteinID: AFR26200
Position
583222..583881
Genome map
AA seq 219 aa AA seqDB search
MNQKGILRFHEELAGLVLKMRSKGIDDVRFFAALEKVPRQQFVASPWCNSAYDNKVIPIE
CGEYIERLEEQLLILFALSLKKKHRILEIGTGSGFCTALMACLSERVITIDRYKTLIDLA
RQKFQTLGIENIVLRQFDGSRTVTGFGSFDRILIWPSRSDEPKEFLELLTENGILIQAIG
PDEGVQTITRYTKIGSRFECLEMFQVRYQPFIEGIAETL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaagggtattttacgatttcatgaggagttggccggtcttgtgctgaaaatg
cgcagcaaaggaattgatgatgttcgcttttttgcagcattggagaaagttccgcggcag
cagtttgtggcttctccttggtgtaacagcgcatatgataataaagttatcccaattgag
tgtggtgaatatattgagcgtttggaagagcagcttttgatcctttttgctttatcgttg
aaaaagaaacatcgcatcttagaaattggtacgggttctggtttttgtactgcccttatg
gcatgtcttagtgaacgtgtaataacaattgatcgctataaaacacttattgatttggcg
cgtcaaaaatttcaaactttgggaattgagaatattgttttacgacagtttgatggaagc
cgtactgttacaggttttggatcgtttgatcgtattcttatttggccatcacgctctgat
gaaccaaaggaatttttagaacttttaactgaaaatggcattctcattcaagccatagga
cccgatgaaggggtacaaacgattacgcgttatacaaaaattggtagccgatttgagtgc
ttagaaatgtttcaagtgcgctatcaaccctttattgaaggtattgcggaaacactttga

DBGET integrated database retrieval system