KEGG   Bartonella quintana RM-11: RM11_0500Help
Entry
RM11_0500         CDS       T02294                                 

Definition
lysophospholipase l2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bqr  Bartonella quintana RM-11
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RM11_0500
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RM11_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(629126..630037)
Genome map
AA seq 303 aa AA seqDB search
MEIPLYPTDWGSPLPDIHNSYLKTAIDRKIRFAITHPKMEKAKGTIVILKSYANALEEYF
LPMNEISNRGFYTTIFDWFDHEGFQPYKRKKTRHNYFDINNDINDLSEFLKNIVYHDCPP
PYYMLTYGIGGLIALSGLDLINHKFNKMLCVSPLFAPFGNKTNSFPHKLTQLLSDIGLGF
LPAKGGKKLKQKKPQFFHTNEAPLSPGFLIKPPTSRWMASVLNAIDRMKKNILNGHLQLP
TLFVLANQNNIANNIEVRQLCQHTHLTDSITITGAELDTIMHEEDYQKQFWAAFDAFIPG
NMP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatacctctttatcctacagactggggttcccctcttcccgatatccacaatagc
tatcttaaaacagctattgatcgcaaaattcgttttgcaataacgcatcccaaaatggaa
aaagccaagggaaccattgttattctcaaaagctatgcaaatgctttagaagaatatttc
ctaccaatgaatgaaatttcgaaccgcggtttttatacaacaatatttgattggtttgat
cacgaaggatttcaaccctataaacgaaaaaagactcgacataattattttgatattaat
aatgatattaatgacttaagtgaatttcttaaaaatattgtttatcatgattgtccgcca
ccttactatatgctaacctatggtataggtggattaatagcacttagtggattggatctt
attaaccataaatttaataaaatgctctgcgtttctcccctttttgctccattcggcaat
aaaacaaatagctttccgcataaattaacacagcttctttccgatataggtcttggattc
ttaccagctaaaggtggaaaaaaattaaaacaaaaaaaaccacaattttttcacaccaat
gaagcacctttatcccctggtttccttataaaacctcctacatctcgatggatggcatca
gtacttaatgcaattgatagaatgaaaaagaacatccttaatggtcatttacaactccca
acactgtttgttcttgccaatcaaaataatattgccaataacattgaagtgcgccaatta
tgtcaacatacgcatctgacagacagtattacaattacgggggctgaactcgatacaatc
atgcatgaagaagattaccaaaaacaattttgggctgcgtttgatgcatttattcccggt
aacatgccataa

DBGET integrated database retrieval system