KEGG   Bartonella quintana RM-11: RM11_0721Help
Entry
RM11_0721         CDS       T02294                                 

Definition
(GenBank) salicylate hydroxylase
  KO
K00480  salicylate hydroxylase [EC:1.14.13.1]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00624  Polycyclic aromatic hydrocarbon degradation
bqr00626  Naphthalene degradation
bqr01100  Metabolic pathways
bqr01120  Microbial metabolism in diverse environments
bqr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    RM11_0721
   00626 Naphthalene degradation
    RM11_0721
   00624 Polycyclic aromatic hydrocarbon degradation
    RM11_0721
Enzymes [BR:bqr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.1  salicylate 1-monooxygenase
     RM11_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Pyr_redox_3 HI0933_like GIDA Thi4 FAD_oxidored Lycopene_cycl Trp_halogenase Pyr_redox
Motif
Other DBs
NCBI-GeneID: 13563594
NCBI-ProteinID: AFR26443
Position
899812..901047
Genome map
AA seq 411 aa AA seqDB search
MDLSPIIVGGGIAGLSSALALAHKGIASTIIEKCKQLDSVGAGIQLTPNATCIFSHWGIL
SKLIEMAITPQFLQLKDGISLKTHLHTDLINLSEKRWKAPYITIHRANLQKVLYNAVIKN
PLIKYKTGETVVSSTQTATSSINIKTIKTDAPTKTEYHQFYSTPLLIGCDGVWSTLRQLA
PLHERANFSGFIAWRATIEFENLPKSFCSLLQNMKTIIAWMGPKNHLVVYPIQPSAKVFN
FVAITHGENSKKGWAHKGKKEELKFLFKDWNQQILQIFDHIDEWSYWPLFQMKYNRFLGL
ERQVFVGDCAHAALPFAAQGAAMAIEDAATLAEVLSLKDCSLMKALSLYQKIRSPRITAV
KKHGDFNRMAYHATGPIAIARNLIMKIRTPESIMSSLDWLYMYDTVNLIKK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggacctatcgccaatcattgttggagggggtattgctggcttaagctctgctttggca
ctcgctcataaaggaattgcaagcactattatcgaaaagtgtaaacagcttgatagtgta
ggtgctggtattcaactcactccaaacgcgacatgcattttttctcattgggggattctt
agcaaactcatagaaatggctataactccgcaatttcttcagttaaaagatggaatatct
ttaaaaacacatctgcacactgatcttattaatttatcagaaaaacgttggaaggctcct
tatattacgattcatcgagccaacttacaaaaagttttatacaacgctgttattaaaaat
ccccttatcaaatacaaaacaggtgaaactgttgtatcgtctacccaaacggcaaccagc
agcattaacataaaaacaataaaaacagatgcaccaactaaaacagaataccaccaattt
tactcaacgcctctcctcattggatgcgatggagtttggtcgacattacggcaattggct
cctcttcacgaaagagcaaattttagtggtttcattgcctggcgtgcaacaatagaattt
gaaaatcttcccaaaagcttttgttctttattacaaaatatgaagacaattatcgcctgg
atgggccccaaaaatcatcttgttgtctatcctattcaaccatcagcaaaagtttttaat
tttgtagccattacgcatggagaaaattcaaaaaaaggatgggcgcataaaggaaaaaaa
gaggagcttaaatttctttttaaagattggaatcagcaaattttgcaaatttttgaccat
attgatgaatggagctattggccgctatttcaaatgaaatataaccgttttttagggtta
gaacgacaagtgtttgttggtgattgtgcacatgcagccttaccctttgcagcacaaggt
gcagctatggcaatagaagacgccgctacattagcagaagtcctctcccttaaagattgt
tcattaatgaaagctctttcactttaccaaaaaatacgcagtcctcgaattacagcggta
aaaaaacatggggattttaacagaatggcctaccatgcaactggtcccatagcaattgca
cgtaatttgatcatgaaaattcgcacaccagaaagcatcatgtctagtcttgattggctt
tatatgtatgatactgtgaacttaataaaaaaatga

DBGET integrated database retrieval system