KEGG   Bartonella quintana RM-11: RM11_0723Help
Entry
RM11_0723         CDS       T02294                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
bqr  Bartonella quintana RM-11
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RM11_0723
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RM11_0723
DNA repair and recombination proteins [BR:bqr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     RM11_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
905407..907515
Genome map
AA seq 702 aa AA seqDB search
MLPDLIRPLFTSVRALPGTSPKICALLAKVLNINPAQREPTVIDLLQLMPQSVIDRRMRP
SIAFAQEGITVTLEIIVDQHHPPPIERNRLPYRVSAHDQTGKINLVFFHAQRPWLKKQLP
EGKKVIVSGKVERFNGQLSMIHPDHIAPSEQSNQMPLIEPVYPSTAGLSAKTLRRTIQNA
LEYIPLLPEWIEESVKKQQNFSSFSVALHRIHTPINPDDLSLKSAARKRLAYDELLACQL
ALGLVRLKTKSLSGASRPPKGTYTKKLLKALPFQLTNGQKKAIQDIANDLASPEPMLRLL
QGDVGAGKTVVALMASAQIAENSGQSALMAPTEVLARQHFATIAPLAEKIGLQTVLLTGR
EKGKLRANILKDTLSGQASIIIGTHALIQNNVAYKNLALTIIDEQHRFGVHQRLALTAKG
NKPDMLVMTATPIPRTLVLTAFGDMDISQITEKPTGRQPITTAILPLQRIHELLERIAIA
LEKGEKLYWICPLVEESTTLELTSIENRFAILRERFGERVGVIHGKMSTDEKEAAMASFK
CGNICILVATTVIEVGVDIPDASIIVIEHAEHFGLSQLHQLRGRVGRGEKKSSCILLYKN
PLTKTAAKRLNIIRNTEDGFKIAEEDWRLRGEGELLGTRQSGMPEFHIANLAVHSDLLLI
ARRDARLFLQHDANFSSKRGKALRLLLDLFRRDDATRLLQAG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcttccagaccttattcgtcctctttttacctctgtccgtgctctgccaggcacgagc
cctaaaatatgtgccttactggccaaagtcttaaacattaatcctgcccaacgtgaacca
accgttattgaccttcttcaattaatgcctcaatctgttatagatcgcagaatgcgaccc
agcattgcttttgcacaagaagggatcaccgttacccttgaaattattgtcgatcagcac
catccgccacccattgaacgcaatcgattaccctatcgtgttagtgctcatgatcaaaca
gggaaaataaatttggtcttttttcatgcccaacgtccttggctaaaaaaacaactccct
gaaggaaagaaagtcattgtatcgggtaaagttgagcgatttaacggacagctttctatg
atccatcctgatcatattgccccaagtgaacaatcaaatcagatgccactgatcgaaccc
gtctatccctctactgccggactatcagcaaagacgctaaggcggacgatacaaaacgcc
cttgaatatattcctctcttgccagaatggatagaggaaagcgtcaaaaaacaacaaaac
ttttcttctttttcggttgctttacaccgtattcacactcccatcaatcctgacgatctc
tccttaaaaagtgcagcacgtaaacgtcttgcctacgatgaattactcgcttgtcaattg
gctcttgggctagtacgtttaaaaaccaaatctctttcaggggcttctcgccccccaaaa
ggaacttacactaaaaaattgctgaaagccttaccttttcaacttacaaatggacaaaaa
aaagcgatacaagatattgccaatgatcttgcttcaccagaacccatgttaaggcttctg
caaggtgatgtaggagcaggaaaaaccgtagttgcactcatggcaagcgcacaaattgct
gaaaattcaggacagtcagctttaatggcaccaacggaagttcttgcccggcaacatttt
gctacgattgctcctcttgccgaaaagatcggattacaaacagttcttttaactggacga
gaaaaaggaaaattgcgcgcaaatattctgaaggatacattatcaggtcaagcctctatt
atcatcggaacccatgccctcatacaaaacaacgttgcctacaagaatcttgccttaacc
attattgatgaacaacatcgttttggcgttcatcaacgtcttgcccttacagcaaaaggc
aataaacctgatatgctcgtaatgaccgccacccctattccacgcacactggtgttgaca
gcttttggtgatatggatatttctcaaattacagaaaaaccaactggacgacaacccatt
acaacagcaatacttcctttgcaacgtattcatgaactcctagaacgaattgccattgca
ttagaaaaaggagaaaaactctactggatttgtcctttagtggaagaatctacaactctt
gaactcacttcaattgaaaatcgttttgctattctccgtgaacgatttggagagcgagtt
ggagttatacatggaaaaatgtctacagatgaaaaagaagcagctatggcatcttttaaa
tgtggaaacatatgcattttagttgcaaccacagtcattgaagtaggagtggatattcca
gatgcctcgatcatcgtcatcgaacatgcagaacattttggcctttcacaactgcaccaa
ttgcgtggacgtgtaggacgaggagaaaaaaaatcctcctgtattttgctatacaaaaat
ccattgacaaaaacggcagcaaaacgccttaatattatacgcaatacagaagatggtttt
aaaattgctgaagaagactggcgtctacgaggagaaggagaacttttaggaacccgacaa
tccggtatgcctgaatttcacatagcaaatcttgcagtccatagtgatcttttgttaata
gcaagaagagatgcgcgtttatttttgcaacatgatgccaatttttcttcaaaacgagga
aaagctttgcgcttactgcttgatcttttcaggcgtgacgacgccactaggctcttacaa
gcaggataa

DBGET integrated database retrieval system