KEGG   Bartonella quintana RM-11: RM11_0724Help
Entry
RM11_0724         CDS       T02294                                 

Definition
(GenBank) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bqr  Bartonella quintana RM-11
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RM11_0724
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RM11_0724
Enzymes [BR:bqr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     RM11_0724
Peptidases [BR:bqr01002]
 Cysteine Peptidases
  Family C44
   RM11_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(907897..909720)
Genome map
AA seq 607 aa AA seqDB search
MCGIIGILGKRCVASSLIAGLKRLEYRGYDSSGIATVHNGRLYRVRAEGKLVHLEEKLKK
TPLKGSLGIGHTRWATHGVAVERNAHPHVTERLAIVHNGIIENFVELQKELIEEGYTFET
ETDTEVIAHLITRALKSGLSQQEAIRTSWKRLQGAFAIVVIFEGQDNLMIAARSGPPLAI
GYGQDEFFVGSDAVALASFVDRISYMEDGDWAVLTREGVTIYGADNQPVKRPITTLFEGT
LLVSKGNHRHFMHKEMFEQPEVISHNLAHYLDLGNYTVRSLKNLIDWKKINRILFASCGT
AYYSTLVARYWFENFAALSVDNDIASEFRYREPPIASDVLSVFVSQSGETADTLACLRYC
REHGVKTATIVNVEQSTMAREADFILPTRAGPEIGVASTKAFTCQLATLAAMALDAAKQR
GSLSEKAEHQFVQQLAEVPRILNEALKLDEKIEQICRDLVNVRGVLYLGRGTSYPIALEG
ALKLKELSYIHAEGYAAGELKHGPIALVDEAIPVIVVAPYDRWFEKTFSNMQEVAARNGR
IILITDKRGAEVAGLDTLSTIVLPNIPEFIAPIIYALPIQLIAYHTAVLLGTDVDQPRNL
AKSVTVE
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattatcggaattcttggaaagagatgtgttgcatcctctttaattgctggt
ttgaagcgtcttgagtacagagggtatgattcatctggtatagcaacagtgcataatgga
cgtctttatcgtgtgcgcgctgaaggtaagcttgttcatttagaggaaaaattaaaaaaa
acacctttaaaaggaagtttagggattggccacacacgttgggctactcatggagttgct
gtggaacggaatgctcatcctcatgtgactgaacggcttgcgattgttcataatggtatt
attgaaaattttgtagaattgcaaaaggaacttattgaggagggttatacttttgaaaca
gagacggatacggaagttattgctcatttaattacacgcgcgttaaaaagtggtctttct
cagcaagaagctatacgtacaagttggaaaaggttgcaaggagcttttgctattgttgtt
atttttgaaggtcaagacaatcttatgattgctgctcgctctggtccaccgctcgcaatt
ggctatggacaagatgaattttttgtcggatcggatgcagtcgctttggcttcatttgta
gatcgcatcagctatatggaagatggtgattgggctgttctcacacgggaaggtgtgaca
atttatggtgcggacaatcaaccggtaaaacgccctattaccacattgtttgaggggact
ttactggtttctaaggggaatcatcgtcattttatgcacaaggaaatgtttgaacagcct
gaagttatttctcataatttggcgcattaccttgatcttggaaattatacggtccgctca
cttaaaaatttgattgattggaagaaaattaatagaatacttttcgcgagctgtggaact
gcttattattcaaccttagttgcgcgctactggtttgagaattttgctgctttaagtgtt
gataatgatattgcttcagaatttcgttatcgtgaaccacccatagcttccgatgtattg
tcggtgttcgtttctcaatctggtgaaacagctgatacgttggcatgtttacgttattgt
cgagaacatggagtaaagacagcaacaattgtgaatgttgagcaatcaacaatggcaaga
gaagctgattttattttaccaacgcgagccggtccagaaattggtgtagcctcaacaaaa
gcttttacttgtcaattggcaacgcttgctgcaatggcgcttgatgctgctaaacaacgt
ggatctctttcagagaaggcagagcaccagtttgttcaacaattggcagaagttcccagg
attttaaacgaggcgttaaagctcgatgagaaaattgaacagatttgtcgtgatttagta
aacgtaagaggtgtcctttatttaggccgtggtacctcttatccgattgctttggagggg
gcacttaaactgaaggagctttcttatattcatgccgaaggctatgcggcgggtgagtta
aaacatgggccgattgcattggtggatgaggcaataccagttattgttgtagccccttat
gataggtggtttgaaaagactttttctaacatgcaagaagtagcagcgcgcaatggtcgt
attattttgataactgataaaagaggagcagaagtagctggtcttgatactttgtcaaca
atcgttttgccaaatattccagaatttattgcgcccattatttatgctttacctattcag
ttaatcgcttaccatacagctgttttattgggaacggatgttgatcaaccccgtaatttg
gcaaaatcagtcactgttgagtaa

DBGET integrated database retrieval system