KEGG   Bartonella quintana RM-11: RM11_0729Help
Entry
RM11_0729         CDS       T02294                                 

Definition
(GenBank) deoxyguanosinetriphosphate triphosphohydrolase-like protein
  KO
K01129  
dGTPase [EC:3.1.5.1]
Organism
bqr  Bartonella quintana RM-11
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RM11_0729
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.5  Triphosphoric-monoester hydrolases
    3.1.5.1  dGTPase
     RM11_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
913712..914734
Genome map
AA seq 340 aa AA seqDB search
MFIADESDHYRTRLTHSIEVSQIARTLARALCLDEDLAEAIALAHDFGHTPFGHAGEDAL
NEAMAHYGGFDHNAQALRIVTKLEQRYANFDGLNLTWETLEGLVKHNGPLLGPYANNKDV
PIDILQYNTKQDLKLNCFAGLEAQCAAIADDIAYNAHDIDDGLRSQFLTLGQFEQVSLTA
VLLQDIEKEHPQLDKTRRGYELVRRQITTMVEDVIKQSQENLARIKPTSISDVQQAEQTI
VTFSPTMAVYEKELKNFLFKNLYYHDQVLSRRNAAKCIVQKLFDCYYKNPNVMPESWHSK
TAHLTNKELARLIADFLSGMTDHYALREYQRLFDCTNNFV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgtttattgctgatgaaagtgatcattatcgtacacgactgacgcattcgatagaggtt
tctcaaattgcacgaaccttagcccgcgcgctctgtcttgacgaggatcttgccgaagct
attgcccttgctcatgactttggacatacgcctttcggccacgcaggagaagatgccctc
aatgaagcaatggcacattatggcggctttgatcataatgcacaagcattacgcattgtt
acaaaactcgaacagcgctatgcaaattttgatgggcttaacctgacttgggaaacactc
gaaggacttgtcaaacataacggcccccttttaggtccctatgcgaacaataaagatgtg
cctattgatattctacaatacaatacaaagcaagatcttaagctcaattgctttgcggga
ctagaagcacaatgtgctgctattgctgatgatattgcttataatgcacatgatattgat
gatggcttacggtcgcaatttttaacacttggtcagtttgaacaggtttcattaaccgca
gtattactacaagatatagaaaaagagcatccacaactcgataaaactcggcgtggttac
gaactggtgcgcagacagataacaaccatggtggaagatgttatcaaacaatcacaagaa
aacttggcacgcatcaaaccaacgagcataagcgatgttcaacaagcagaacaaaccatc
gttaccttttcgcccacaatggccgtttacgaaaaagaactaaaaaactttctgtttaaa
aatctttattaccatgatcaagtcctcagtcgtcgtaatgcggcaaaatgcattgtacaa
aagttatttgactgttattataaaaatccaaatgtaatgcctgaaagttggcacagtaaa
acagctcacttaacaaataaagagttagcacgtctcattgcggactttctgtcaggtatg
accgatcactatgctctacgtgaatatcagcgtttatttgattgcacaaataatttcgtt
taa

DBGET integrated database retrieval system