KEGG   Bartonella quintana RM-11: RM11_0730Help
Entry
RM11_0730         CDS       T02294                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
bqr  Bartonella quintana RM-11
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    RM11_0730
Enzymes [BR:bqr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     RM11_0730
Amino acid related enzymes [BR:bqr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   RM11_0730
Transfer RNA biogenesis [BR:bqr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RM11_0730
 Prokaryotic Type
   Other AARSs
    RM11_0730
Mitochondrial biogenesis [BR:bqr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RM11_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
914765..916522
Genome map
AA seq 585 aa AA seqDB search
MNVFKNFEKKIKKSLELSDIKGKNGEDLNLSKITVDPPRDSSHGHLSTNAAMVLAKSIGL
NPHALAEKIIELLKNDSSIDCIDIAAPGFINIKLTKSFWQDAIKSMLKKGTSYGRIPMGQ
GKRINVEYVSANPTGPMHVGHCRGAVFGDVLSNLLQFVGYNITKEYYINDAGKQIEVLAH
SVLLRYREALGQKINEIPEGLYPGEYLIPLGQSLAQEFSDQLLTIDKDEALSIVKERAIY
AMMSMIRKDLAALNIYHDIFFSERMLYADNARAIRNTINDLTLNGYIYKGELPPPKGQNT
EDWEPREQTLFRSTDVGDDQDRVLVKSDGSYTYFAADVAYFRDKFNRHFDEMIYILGADH
AGYVKRLEAMAKAISGNSAKLSVFLCQLVKLFRNGHPVRMSKRAGSFVTLRDVVEEVGRD
PVRFMMLYRKCEAPLDFDFAKVTEQSKDNPIFYVQYASARCHSVFRQAQEIFRIENVSND
TMIAHLNRLTDDNEIFLIRKLSEYPRIIEQAVVHKEPHRLAFYLYDLASSFHAHWNKGSD
NFDLRFIQPDDKELSFARLGLIQAIMNILSSGLAIVGIEAATEMR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtctttaaaaacttcgaaaaaaaaattaaaaaatcactagagttatctgatata
aaaggaaaaaatggagaagacttaaatttatcaaaaattaccgttgatcctccacgcgat
tcctcacatggccatttatcaaccaatgctgccatggtgcttgcaaagtctattggactt
aatccgcatgcacttgcagaaaagattatagaacttctcaaaaatgattcctctatcgat
tgtattgatattgccgctcctggatttatcaatatcaagcttacaaaatcattttggcaa
gatgcaataaaatccatgcttaaaaaaggtacgtcttatggccgtattccaatgggacag
ggaaaacgcattaatgttgagtatgtatcagcaaatccgacaggtcccatgcatgtagga
cattgccggggtgccgtttttggagatgtgctctccaatttgcttcaatttgttggctat
aacattacgaaagaatattacatcaatgatgctggtaaacaaattgaagtactagcccat
tccgtactgttgcgttatcgcgaagcccttggacaaaaaattaatgaaattccagaagga
ctgtatcctggtgaatatctgataccattgggacaatcgcttgctcaagagtttagtgat
caattactcactatcgataaagacgaagctttatcgatagtgaaagaacgtgcaatttat
gcaatgatgtcaatgattcgcaaagatttagctgcccttaatatttatcatgatatcttt
ttctctgagcggatgctttatgctgataatgcgcgcgctattcgtaacacgattaatgat
cttactttaaacggctatatctacaaaggtgagctcccaccaccaaaaggacaaaacaca
gaagactgggaaccacgtgaacaaactttgttccgttccactgatgttggagatgatcag
gaccgtgtcttagttaaatctgatggttcttacacttattttgctgctgatgttgcttat
tttcgtgataaattcaatcgtcattttgatgaaatgatttatattttaggtgcagatcac
gctggttatgtaaagcggttggaggcgatggcaaaagcaatttctggcaatagtgctaaa
ttgagcgtttttttatgtcaattggtaaaactctttcgcaatggtcaccctgtacgcatg
tcgaaaagagcaggatcatttgtaactttacgtgatgttgtagaagaagtcggccgtgat
ccagtacgttttatgatgctgtaccgtaagtgtgaagcacctcttgattttgattttgca
aaagtgacagaacaatcaaaagataaccctatcttttacgtacaatatgcaagtgcacgt
tgtcactcagtttttcgtcaagcgcaagagattttccgtattgaaaatgtttcaaatgac
acaatgattgcacatcttaatcgattaacagacgataatgagatattcttaatacgcaaa
ctttctgaatatccacgcatcattgaacaagccgtagttcataaagagccacatcgattg
gcgttttatctctatgatcttgcttccagctttcacgcccattggaataaagggagtgat
aatttcgatttacgctttattcagcctgatgataaagaactctcatttgccagattggga
ttaatacaagcgatcatgaatattttatcatcaggacttgcaattgtaggaatcgaagca
gcaacagaaatgcgttga

DBGET integrated database retrieval system