KEGG   Bartonella quintana RM-11: RM11_0743Help
Entry
RM11_0743         CDS       T02294                                 

Definition
(GenBank) hypothetical protein
  KO
K00773  
queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
bqr  Bartonella quintana RM-11
Brite
Enzymes [BR:bqr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     RM11_0743
Transfer RNA biogenesis [BR:bqr03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    RM11_0743
 Prokaryotic Type
    RM11_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(931726..931980)
Genome map
AA seq 84 aa AA seqDB search
MQQLDQCIALPVSEKEMKSAMELSLRWAQRCKTAFGDQPNKALFGIFQGGENVKIRERSA
QALKEMNLKGMLLEGLQLVNRKVL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagctagatcaatgtatagcattacctgtaagtgaaaaagaaatgaagtctgct
atggagctttcattgcggtgggcacagcgttgtaaaacagcttttggtgatcagccaaac
aaagcgttgtttggtatttttcaaggcggtgaaaatgtgaaaatacgtgaacgttctgcc
caagcattaaaagaaatgaatttgaaaggtatgctattggagggcttgcagttggtgaac
cgcaaagtgctatga

DBGET integrated database retrieval system