KEGG   Bartonella quintana RM-11: RM11_0746Help
Entry
RM11_0746         CDS       T02294                                 

Definition
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  
pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bqr  Bartonella quintana RM-11
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RM11_0746
Enzymes [BR:bqr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     RM11_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(933688..934206)
Genome map
AA seq 172 aa AA seqDB search
MKIALYAGSFDPLTNGHIAILQGSFVLADKVVVAIGMQAKKKSLFSFEERVDLITQVGKD
LLSIGPDRLQVISFDTLLIDKAREIGASFLIRGLRDGTDLDYEMQMAGMNGVMAPELQTV
FLPASVSGRAITSTLVRQIASMGGDVSAFVPPNVERALHLKFQFSRENGCVS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctctttatgccggttccttcgatcctcttacaaatggtcatattgctatt
ttgcaaggcagttttgttttggctgataaggtggttgtggctataggcatgcaggctaaa
aaaaaatcactttttagttttgaagaacgtgttgatttaattacccaggtagggaaagat
ttgttaagtataggtcctgatcgattacaggttatttcgtttgatactcttttgattgat
aaggcgcgtgaaattggtgcttcatttcttattcgtgggttacgtgatggcactgacctt
gactatgaaatgcaaatggcggggatgaatggtgttatggctcctgaattacaaactgtt
tttttgccggcgagtgtttcagggcgtgcgataacttctaccttggtgcgccagattgcc
tctatgggaggtgatgtatcagcctttgtacctcccaatgttgaacgagctttgcactta
aaatttcaattttcaagggaaaatggttgtgtttcttaa

DBGET integrated database retrieval system