KEGG   Bartonella quintana RM-11: RM11_0751Help
Entry
RM11_0751         CDS       T02294                                 

Definition
(GenBank) glutamine synthetase I
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00220  Arginine biosynthesis
bqr00250  Alanine, aspartate and glutamate metabolism
bqr00630  Glyoxylate and dicarboxylate metabolism
bqr00910  Nitrogen metabolism
bqr01100  Metabolic pathways
bqr01120  Microbial metabolism in diverse environments
bqr01230  Biosynthesis of amino acids
bqr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RM11_0751
  Energy metabolism
   00910 Nitrogen metabolism
    RM11_0751
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RM11_0751
   00220 Arginine biosynthesis
    RM11_0751
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RM11_0751
Enzymes [BR:bqr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     RM11_0751
Exosome [BR:bqr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RM11_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-GeneID: 13563624
NCBI-ProteinID: AFR26472
Position
941677..943086
Genome map
AA seq 469 aa AA seqDB search
MITASDILKKITDNDIRFVDLRFTDPRGKLHHVTIDNAEISEDTFNDGVLFDGSSISGWK
TINESDMVLMPDPETAHIDPFFAQSTLVIFCDVLDPVSGEFYRRDPRSIAKRAEVYMKSL
GIGDTINVGPEAEFFIFDDVRYKTDPYNTGFKLDSAEFPSNDDTEYETGNFGHRPRIKGG
YLPVPPVDSCQDIRSEMLTALKDMGVRVEKHHHEVAAGQHELGIRFDTLVREADKIQIFK
YVVHQIAKSYGKTATFMPKPVFGDNGSGMHVHMSIWKDGKPIFAGNEYAGLSETCLFFIG
GIIKHAKAINAFTNPSTNSYKRLVPGYEAPVLLAYSARNRSASCRIPMGFSPNSKRVEVR
FPDPTANPYFAFAALLMAGLDGIKNKIHPGHAMDKDLYDLPPKELKEIPTVSGSLREALE
ELDKDRRFLKAGDVFDDDQINSFIQVKMQEVLRYETTPHPIEFDMYYSV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgataaccgcatcagacattcttaaaaaaattacagacaatgacatacgttttgtcgat
ttacgctttactgatccaagagggaaattgcatcacgtcacaatcgataatgcagaaatc
agtgaagatacatttaatgatggtgttctgtttgatggttcttcaatttctggatggaaa
acaattaatgaatccgacatggttttgatgccagatccagaaacagcacatattgatcct
ttttttgctcaatcaactttggtcatattttgtgatgtgctcgatcctgtttcgggagaa
ttttatcgcagagatcctcgttctatcgccaaaagagctgaagtttatatgaaatcttta
ggaattggagatacaatcaatgtaggtccagaagcagaattttttatctttgatgatgta
cgctataaaactgacccttacaatacaggatttaaactcgattcagctgaatttccatca
aatgatgatactgaatatgagacaggtaatttcggccatcgcccacggataaagggggga
tatcttccagttcctccagttgattcctgccaagatatacgctctgaaatgctgacagca
ctaaaagatatgggtgttcgcgttgagaaacatcatcacgaagtggctgcgggccagcat
gaattgggtattcgctttgatactctcgttcgtgaagctgataagatacaaatttttaaa
tatgttgtgcatcaaatagcaaaaagctacggaaaaacagcaactttcatgccaaaaccg
gttttcggtgataacggctcaggtatgcatgttcacatgtccatctggaaagatggcaaa
ccaatctttgccggaaatgaatatgccggactatcagaaacttgcttattctttatcggt
ggtatcattaagcatgcaaaagcaatcaatgccttcaccaatccatctacaaactcctat
aagcgtttggttcctggttacgaagctcctgtccttcttgcttattccgcacgtaatcgt
tctgcatcttgccgtattcccatgggtttttcgccaaattcaaaacgcgtagaagttcgt
ttcccagacccaacagcaaatccgtattttgcgtttgcagcactcttaatggctggtctt
gatggcattaaaaacaaaattcatcctggccatgctatggataaagacctttatgatctt
ccaccaaaagagctcaaagaaattcccacggtctcaggaagtctgcgcgaagcacttgaa
gaactcgataaagatcgtcgctttcttaaagctggtgacgtttttgatgatgatcaaatt
aattctttcattcaagtaaaaatgcaagaagtcttgcgctacgaaacaactccacatcct
atcgaatttgatatgtattattccgtttaa

DBGET integrated database retrieval system