KEGG   Bartonella quintana RM-11: RM11_0751Help
Entry
RM11_0751         CDS       T02294                                 

Definition
(GenBank) glutamine synthetase I
  KO
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
bqr  Bartonella quintana RM-11
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RM11_0751
  Energy metabolism
   00910 Nitrogen metabolism
    RM11_0751
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RM11_0751
   00220 Arginine biosynthesis
    RM11_0751
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RM11_0751
Enzymes [BR:bqr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     RM11_0751
Exosome [BR:bqr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RM11_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
941677..943086
Genome map
AA seq 469 aa AA seqDB search
MITASDILKKITDNDIRFVDLRFTDPRGKLHHVTIDNAEISEDTFNDGVLFDGSSISGWK
TINESDMVLMPDPETAHIDPFFAQSTLVIFCDVLDPVSGEFYRRDPRSIAKRAEVYMKSL
GIGDTINVGPEAEFFIFDDVRYKTDPYNTGFKLDSAEFPSNDDTEYETGNFGHRPRIKGG
YLPVPPVDSCQDIRSEMLTALKDMGVRVEKHHHEVAAGQHELGIRFDTLVREADKIQIFK
YVVHQIAKSYGKTATFMPKPVFGDNGSGMHVHMSIWKDGKPIFAGNEYAGLSETCLFFIG
GIIKHAKAINAFTNPSTNSYKRLVPGYEAPVLLAYSARNRSASCRIPMGFSPNSKRVEVR
FPDPTANPYFAFAALLMAGLDGIKNKIHPGHAMDKDLYDLPPKELKEIPTVSGSLREALE
ELDKDRRFLKAGDVFDDDQINSFIQVKMQEVLRYETTPHPIEFDMYYSV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgataaccgcatcagacattcttaaaaaaattacagacaatgacatacgttttgtcgat
ttacgctttactgatccaagagggaaattgcatcacgtcacaatcgataatgcagaaatc
agtgaagatacatttaatgatggtgttctgtttgatggttcttcaatttctggatggaaa
acaattaatgaatccgacatggttttgatgccagatccagaaacagcacatattgatcct
ttttttgctcaatcaactttggtcatattttgtgatgtgctcgatcctgtttcgggagaa
ttttatcgcagagatcctcgttctatcgccaaaagagctgaagtttatatgaaatcttta
ggaattggagatacaatcaatgtaggtccagaagcagaattttttatctttgatgatgta
cgctataaaactgacccttacaatacaggatttaaactcgattcagctgaatttccatca
aatgatgatactgaatatgagacaggtaatttcggccatcgcccacggataaagggggga
tatcttccagttcctccagttgattcctgccaagatatacgctctgaaatgctgacagca
ctaaaagatatgggtgttcgcgttgagaaacatcatcacgaagtggctgcgggccagcat
gaattgggtattcgctttgatactctcgttcgtgaagctgataagatacaaatttttaaa
tatgttgtgcatcaaatagcaaaaagctacggaaaaacagcaactttcatgccaaaaccg
gttttcggtgataacggctcaggtatgcatgttcacatgtccatctggaaagatggcaaa
ccaatctttgccggaaatgaatatgccggactatcagaaacttgcttattctttatcggt
ggtatcattaagcatgcaaaagcaatcaatgccttcaccaatccatctacaaactcctat
aagcgtttggttcctggttacgaagctcctgtccttcttgcttattccgcacgtaatcgt
tctgcatcttgccgtattcccatgggtttttcgccaaattcaaaacgcgtagaagttcgt
ttcccagacccaacagcaaatccgtattttgcgtttgcagcactcttaatggctggtctt
gatggcattaaaaacaaaattcatcctggccatgctatggataaagacctttatgatctt
ccaccaaaagagctcaaagaaattcccacggtctcaggaagtctgcgcgaagcacttgaa
gaactcgataaagatcgtcgctttcttaaagctggtgacgtttttgatgatgatcaaatt
aattctttcattcaagtaaaaatgcaagaagtcttgcgctacgaaacaactccacatcct
atcgaatttgatatgtattattccgtttaa

DBGET integrated database retrieval system