KEGG   Bartonella quintana RM-11: RM11_0754Help
Entry
RM11_0754         CDS       T02294                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase c
  KO
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
bqr  Bartonella quintana RM-11
Brite
Enzymes [BR:bqr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     RM11_0754
Ribosome biogenesis [BR:bqr03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    RM11_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(945228..946211)
Genome map
AA seq 327 aa AA seqDB search
MAGVEIKKVEEDESGMRLDRWFKVYYPALGFGYLQKLLRSGQIRVDGGRVKADTRLLIGQ
VVRVPPLLVDEKEGLPVTDKIIREQDDRVILKKMLLYEDSKIFVFNKPAGLAVQGGSGLT
RHFDSMLEVWRNKKGEKPRLVHRLDRETSGVLIVARSRGAAQTLTAAFRARETKKTYWAL
VRGVPKKKQDKISTWVVKDITAQGDKMRVCEHGEPDSNHAVSYYRVLDTRGRALSWLEME
PYTGRTHQLRVHAAYMDNPIIGDSKYFFSDSNWKLPRGIQNRLHLHARRIRIPHPSGGIL
DIVAPLPPHMVQSFNLLAFNEMDGDKE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgtagaaataaaaaaggttgaggaagatgaaagcggaatgcgcttagatcgc
tggtttaaagtgtattatccagcacttgggtttggatatttacaaaagttgctacgttct
ggccagataagggtggatggtgggcgtgttaaagccgatacgcgtctcctcataggacaa
gttgtgcgggttccacctttacttgttgatgaaaaagagggtcttcctgtaacggataaa
ataattcgtgagcaggatgacagagtcattttgaaaaaaatgctgctctatgaagattcc
aaaatttttgtttttaataagcctgcggggttagctgtacaaggtggttctggtttaacg
cgtcattttgatagtatgcttgaggtgtggcgcaataaaaaaggtgaaaaaccgcgtttg
gttcatcgtcttgatcgtgagacatcaggtgtgctcattgttgcacgctcaaggggggct
gcacagactttaactgctgcttttagagcgcgggaaacgaaaaagacttattgggctttg
gttcggggagtgcctaaaaaaaagcaggataaaatttcaacatgggtagttaaggacatc
actgcacaaggtgataaaatgcgtgtttgtgagcatggagagccagattctaaccatgca
gtttcctactatcgtgttttagatacccgagggcgggctctttcgtggcttgaaatggaa
ccttatacagggagaacacatcagctacgtgtgcatgctgcctatatggataaccctatt
attggagattcaaaatattttttttctgatagcaattggaagttaccaagaggaatacaa
aatcgacttcatcttcatgcacgccggattcgtatcccgcatccttcaggcgggatatta
gatattgtcgcacctttaccgcctcatatggtacaaagctttaatcttctggcttttaat
gaaatggatggtgataaagaatag

DBGET integrated database retrieval system