KEGG   Bartonella quintana RM-11: RM11_0756Help
Entry
RM11_0756         CDS       T02294                                 

Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
bqr  Bartonella quintana RM-11
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    RM11_0756
Enzymes [BR:bqr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     RM11_0756
Amino acid related enzymes [BR:bqr01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   RM11_0756
Transfer RNA biogenesis [BR:bqr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RM11_0756
 Prokaryotic Type
    RM11_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(948410..951043)
Genome map
AA seq 877 aa AA seqDB search
MDYFHLNGHKVLSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPCKQATTAQKCVRVG
GKHNDLDNVGYTARHHTFFEMLGNFSFSDYFKEEAIFLSWNLLTKEFCLPKDKLLVTVYH
SDDVAAELWRKISNLSDEKIVRIATVDNFWAMGETGPCGPCSEIFYDHGDEIWGGPPGSA
NEGGDRFIEIWNLVFMQYEQVSKEERVELPHPSIDTGMGLERIAAVLQGVHDNYDIDLFR
ALIGASQEITGVEATGDFIASHRVISDHLRSCAFLIADGVLPSNEGRGYVLRRIMRRAMR
HAHFLGVKEPLMWRLLPALVREMGQAYPELVRAESLISETLKLEEMRFRKTLERGLGLLN
EASSNLKEGDHFNGEIAFKLYDTYGFPLDLTQDALRCRGISVDVDAFDKAMQRQKTEARA
NWSGSGEAVTETIWFAILDRVGATEFLGYEIEKAEGIITALICDGKVVDHISSGQKAILV
VNQTPFYGESGGQIGDSGIISSGCFVFEVHDTQRKSNGVFIHIGEVKSGQAKTFECVELT
VDVIRRQKIRANHSATHLLHEALRQILGPHVTQKGSLVLPDRLRFDFSHPKSVSSEELKK
IEDLANDIVLQNSEVTTHLMALDDAISEGAMALFGEKYGDEVRVVSMGNTLEPEGLKKRW
SIELCGGTHVERTGDIGLIHIVSESSVAAGVRRIEALTGTAARLYLNRQDERIREISSLL
KTVPADVGERVSNLLHEYNRLSQACIELRKKIILSGNTIKNNQEDITIINGISFMGRVVR
NILPRDLKALVDDGKKQIGSGVVAVISVAENGKGSAVVGVTDDLTDKLNAVDLIHILSDV
LGGKGGGGRPDMAQSGGPEGDKAVGALAALKASLEKI
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
ttggattattttcatcttaatgggcataaagttctttcttctagcccacttgttccacgt
aacgatcccacactcatgtttacaaatgcaggaatggtgcagtttaaaaatgtttttact
ggacttgaacagcgtccttgtaaacaggcaacaactgcacaaaaatgtgtccgtgtgggg
ggaaagcataatgatcttgataatgttggctatacggcacgccatcatacattttttgaa
atgttgggtaatttttctttcagtgattatttcaaagaagaagcgatttttttgtcatgg
aatcttttaacgaaagaattttgtcttccaaaggataaattgttggtgacagtttatcat
agtgatgatgtcgctgctgaactgtggcgtaaaatttcaaatctttcagacgaaaaaatt
gtccgtattgcgacagttgataatttttgggcgatgggggagacaggaccttgtggtcct
tgttccgagattttttatgatcatggtgatgaaatttggggaggacctcctggcagtgcg
aatgaaggtggtgatcgctttattgagatttggaatcttgtctttatgcagtatgagcag
gtaagcaaggaagagcgtgttgaattgcctcatccttctattgatacaggtatgggatta
gagcgcattgctgctgttttgcaaggtgttcacgataattacgatattgatctttttcgt
gcgttaattggtgcgtcacaagagataacaggggttgaggcaacgggtgattttattgcg
agtcatcgtgtgatttctgatcatcttcgctcatgtgcatttttgattgctgatggtgtt
cttccgtccaatgaaggaaggggatatgttttacgtcgtattatgcgtcgtgctatgcgt
catgcgcattttcttggtgttaaagaaccattgatgtggcgtcttttgcctgctttagtt
cgcgaaatgggacaagcctatcctgaattggtgcgtgctgaatctttgatttcagaaact
ttgaagttagaagagatgcgttttcgtaaaactcttgaacgagggcttggtttgttgaac
gaagcaagtagcaatcttaaagaaggggatcattttaatggtgaaatcgctttcaagctt
tatgatacctatggttttccgctcgatttgacacaggatgctcttcgatgtcgtggaata
tctgttgatgttgatgcttttgataaagcgatgcaacgtcagaaaacggaagcgcgtgcc
aattggtctggttctggtgaagctgtaacagagacaatctggtttgctatccttgatcga
gtgggagctacagaatttttgggttatgaaatagaaaaagctgaaggcattattacagct
cttatttgtgatggtaaagttgttgatcatatttcttcaggacagaaagctattcttgtt
gttaatcaaacacctttttatggtgaatctggtgggcagattggtgatagtggtatcatt
tctagtgggtgttttgtttttgaagtgcatgatacccagagaaagagtaatggtgttttt
atccatattggagaagttaaatctggtcaggcaaagacatttgagtgtgtagaattaact
gtagatgttattcgtcgtcaaaaaatccgtgcgaaccattctgctacccacttattacac
gaagctttacgccaaatattgggacctcatgttacacaaaaaggttctcttgtattgcca
gatcggttgcgttttgatttttctcatccaaaatccgtttcttcagaagaactgaagaaa
atagaggatttagcaaatgacattgttttgcaaaatagtgaagtaacaacacatctcatg
gctctggatgatgcaatttctgaaggagcgatggcattatttggtgaaaaatatggcgat
gaggttcgcgttgtttctatggggaacacgcttgaaccggaaggactgaaaaagcgttgg
tcaattgagctttgtgggggcacgcatgtggagagaacaggggatatcggtctaattcat
atcgtttctgaaagttctgtagcggctggagtacgtcgtattgaagctttaacaggcaca
gctgcgcgcctttatcttaatcgccaagatgagagaatccgtgaaatttctagcctttta
aaaactgttcctgctgatgtgggagagcgtgttagtaatttactgcatgagtataatagg
ctttcacaagcatgtattgagttacgcaagaaaattatattgagtggtaatacgataaag
aataatcaagaagatattacaatcatcaatggtatttcctttatgggacgtgttgttaga
aatattttaccacgggatcttaaagcattagtggatgatggaaaaaaacagattggatct
ggagtcgttgccgtcataagtgttgcagagaatggtaaagggagtgccgttgttggggtt
acagatgatttaacggataaattaaatgctgttgatctcattcatattctttcagatgtt
cttggtggtaaaggtggtggtggtcgtcctgatatggcacagtctggtggtcctgaaggg
gataaagctgttggtgcacttgcagcgttaaaagcttctcttgaaaaaatttga

DBGET integrated database retrieval system