KEGG   Bartonella quintana RM-11: RM11_0757Help
Entry
RM11_0757         CDS       T02294                                 

Definition
(GenBank) recombinase A
  KO
K03553  
recombination protein RecA
Organism
bqr  Bartonella quintana RM-11
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RM11_0757
DNA repair and recombination proteins [BR:bqr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RM11_0757
    RecFOR pathway proteins
     RM11_0757
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    RM11_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(951287..952330)
Genome map
AA seq 347 aa AA seqDB search
MDKTKALDAALSQIERSFGKGSIMRLGQKEQVVEIETIPTGSLSLDIALGVGGLPKGRIV
EIYGPESSGKTTLALHAIAEAQKNGGVCAFIDAEHALDPIYARKLGVDLENLFISQPDTG
EQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDALPGLQARLMSKALRKLTASI
FRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGSIKDRDMIVGNQT
RVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGSWFSYNSQRLGQGR
ENAKQFLREHAEIATEIETALRQNAGLIAIELLENAGSENTESDEAI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaacaaaagctctcgatgctgctctctcacaaattgaacgttcttttggtaaa
ggctcaattatgcgtcttgggcaaaaagagcaggttgttgaaattgaaacaatcccaact
ggttcattatctttggatattgctttgggtgttggtggattaccgaaggggcgtattgtt
gaaatttatggaccagaaagttctggaaaaacaacattagctcttcatgctattgctgaa
gcacaaaaaaatggtggggtttgcgcttttattgatgcggagcacgctcttgatcctatt
tatgcgcgtaaacttggtgttgatttagagaacttgttcatttctcagccagataccggt
gaacaggcattggaaattaccgagacacttgttcgttctggtgcggttgatgtactcgtt
gttgattccgtagccgctttgacgccgcgtgcggaaattgatggtgaaatgggtgatgct
ttgcccggattgcaagctcggttgatgagcaaagctttgcgaaaattaaccgcatcgatt
ttccgctctaactgtatggtgatctttattaaccaaattcgtatgaaaattggggtgatg
tttggttctcctgaaacgacaacaggcggaaacgctttaaagttttatgcttctgttcgt
ttggacattcgccgcgttggctccattaaagatcgggatatgattgttggtaaccagaca
cgtgttaaagtggtcaaaaataaattggcgcctccatttaaacaggttgagtttgacatt
atttatggtgaaggtatttctaaattaggtgagttgattgatttaggtgtcaaagttggc
attgtggaaaagtcaggttcgtggttctcttataattctcaacgtttaggacaagggcga
gaaaatgcgaagcagtttttacgcgaacacgcagagatagcaacagagatcgaaacggct
ttgcgtcaaaatgctggtttgattgcgattgagttgttagaaaatgcaggatcagaaaat
acagaaagcgatgaagcaatttga

DBGET integrated database retrieval system