KEGG   Bartonella quintana RM-11: RM11_0758Help
Entry
RM11_0758         CDS       T02294                                 

Definition
(GenBank) recombination factor protein RarA
  KO
K07478  
putative ATPase
Organism
bqr  Bartonella quintana RM-11
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(952940..954259)
Genome map
AA seq 439 aa AA seqDB search
MSKDFFTSSFDLQVNKKRPLPERMRPRSLKDVTGQNHLLGEKGLLSRMVVAGSIGSMIFW
GPPGTGKTTVARLLALEKKFAFEQVSAIFTGVSELKKIFEVAQARFMSGCKMLLFVDEIH
RFNRAQQDSFLPFMEDGTVILIGATTENPSFELNAALLSRARVLTFLPHDNESLSMLLKR
AEKVEGKILPLDDDARDVLIGMSDGDARAALTLAEEVWSVAQPGEIFDAGTLQKIIQRRA
PIYDKGRDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYIGRRLVRMAVEDVGL
ADPQALVICNAAKDAYDYLGSPEGELALAQACLYVATAPKSNATYLAYKAAMHSARKNGS
FPPPRHILNAPTKFMKEEGYGHGYRYDHDEPDAFSGQEYFPEQLGQQIYYQPRERGFERE
IAKRLEWWKQLRKKRGNQK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaggatttttttacttcgtcttttgatcttcaggttaataaaaaacggccgctt
ccagaaagaatgcgccctcgctctcttaaagatgtaacgggacaaaatcatctgcttgga
gagaaaggtttgctttcacgcatggtggtggctggctcaattggttcgatgattttctgg
gggcctccaggaacaggaaaaacgacagttgcacgtttgttagcacttgaaaaaaaattc
gcttttgagcaagtttctgctattttcactggggtttctgagcttaagaaaatttttgaa
gttgctcaagcgcgttttatgtctggatgtaaaatgcttttgtttgtcgatgaaattcat
cgctttaatcgtgcgcaacaggatagttttcttccgtttatggaggatggtactgtaatt
cttattggtgcaacgacagaaaacccttcatttgaacttaatgctgcacttctttctcgc
gcacgtgttttgacatttcttccacatgacaatgaaagtttgagtatgcttttgaaacgc
gctgaaaaagtagaaggaaagattcttcccttggatgatgatgccagagatgtgttaata
ggaatgtctgacggtgatgcacgggcagcgttaacattggcagaggaagtttggtctgtt
gcacagccgggtgagatattcgatgctggtaccttgcaaaaaattattcagcgtcgtgct
ccaatttatgataaggggcgagatggtcattataatctcatttcagccttgcataaatcc
gttcgtggatctgatcctgatgctgctctttattatttagcacgtatgtttgacgcgggg
gaagatcctttatacattgggcgaagattggttcgtatggctgttgaagatgtcggttta
gcagatccgcaagctcttgttatttgtaatgcggcaaaagacgcttatgattatttagga
tcacctgagggagaattggctttggcgcaagcgtgtctttatgttgcaactgcaccaaaa
tcaaatgcaacatatctcgcgtataaggcagctatgcatagtgcacgtaaaaatggttct
tttcctcctcctaggcatatccttaatgcgcctacaaaatttatgaaagaagaagggtat
gggcatggttatcgctatgatcatgatgaaccagatgctttttcaggacaggaatatttt
cctgaacagcttgggcagcagatctattatcaaccacgagaacggggttttgaacgtgag
attgcgaagcgtcttgagtggtggaagcaattgcgcaaaaagcgaggcaatcaaaagtga

DBGET integrated database retrieval system