KEGG   Bartonella quintana RM-11: RM11_0767Help
Entry
RM11_0767         CDS       T02294                                 

Definition
(GenBank) 50S ribosomal protein L30
  KO
K02907  
large subunit ribosomal protein L30
Organism
bqr  Bartonella quintana RM-11
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    RM11_0767
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    RM11_0767
  Bacteria
    RM11_0767
  Archaea
    RM11_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(961090..961296)
Genome map
AA seq 68 aa AA seqDB search
MVQRKSQDGKTVMVEQIGSPIRNSRIQHATLKGLGLNKMRRRRVLKDTLCVRGMIAKVRH
LVRVIDEG
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaagaaaatctcaggatgggaaaactgtgatggtagagcaaattgggagtccg
attcggaattcacggattcagcatgcgaccttgaaggggcttgggttgaataaaatgcgt
cgtcggcgtgttttgaaggatacactttgtgtgcggggtatgattgctaaggttcggcat
cttgttcgggttatagatgaaggttaa

DBGET integrated database retrieval system