KEGG   Bartonella quintana RM-11: RM11_0777Help
Entry
RM11_0777         CDS       T02294                                 

Definition
(GenBank) 30S ribosomal protein S3
  KO
K02982  
small subunit ribosomal protein S3
Organism
bqr  Bartonella quintana RM-11
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    RM11_0777
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    RM11_0777
  Archaea
    RM11_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(965986..966696)
Genome map
AA seq 236 aa AA seqDB search
MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLSIRLYVLEELKQAAISKVIIERP
HKKCRVTIYSARPGLIIGKKGADIEKLRRKLSEMTNAETSLNIVEIHKPEIDATIIAQSI
AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRS
DVDYGTAEAKTAYGICGVKVWVFKGEILEYDPIASERRSVEIDHSGSSSNRRRENA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaagatcaatccaataggacttcgtcttggagttaatcggacctgggattct
cgctggtatgctgatagtggtgagtatggacgtcttcttcatgaggatttgagcatccgt
ttatatgtgcttgaagaattaaagcaagctgctatttctaaagttattattgagcgtccc
cataagaaatgtcgtgtaacgatttattcagcgcgtcctggtctaattattggtaagaaa
ggtgctgatatcgaaaagcttcgtcgtaagctttcggaaatgacaaatgctgagacttca
ttgaatattgtggaaattcataagccggagattgatgcaacaattattgcgcagtcaatt
gctcagcagttagaacgtcgtgttgcttttcggcgtgccatgaagcgtgcagttcaatca
gctatgcgtcttggcgcagaaggcattcgtatcaattgttctggtcgtcttggtggtgct
gaaattgctcgtatggaatggtatcgtgaaggtcgtgttccacttcataccttgcgttct
gatgtcgattacggtacagcagaggctaagactgcttatggtatttgtggtgttaaagtt
tgggtctttaagggcgagattctcgagtacgatccgatagcttcagaacgtcgttctgta
gaaattgatcattccgggtcttcatcgaatcgtcgtcgtgaaaatgcttag

DBGET integrated database retrieval system