KEGG   Bartonella quintana RM-11: RM11_0780Help
Entry
RM11_0780         CDS       T02294                                 

Definition
(GenBank) 50S ribosomal protein L2
  KO
K02886  
large subunit ribosomal protein L2
Organism
bqr  Bartonella quintana RM-11
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    RM11_0780
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    RM11_0780
  Bacteria
    RM11_0780
  Archaea
    RM11_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(967382..968215)
Genome map
AA seq 277 aa AA seqDB search
MAFKHFNPTTPGQRQLVIVDRSCLYKGKSVKALTAGLSSKGGRNNHGRVTARFQGGGHKR
SYRFVDFKRLKRGVFAKVERLEYDPNRTAFIALIRYEDGQLSYILAPQRLDVGDSIIAGS
NVDVKPGNAMPLGNMPVGTIIHNVEMKPGKGGQIARSAGTYAQLVGRGQGMVILRLNSGE
QRLVSGSCFATVGAVSNPDHANINDGKAGRSRWRGKRPHVRGVAMNPVDHPHGGGEGRTS
GGRHPVSPWGKSTKGKRTRSNKATDKFIMHTRHQRKK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaagcactttaatccaactacgcccgggcagcgtcagcttgttattgtagat
cgttcttgtctttataaggggaagtctgtaaaagctttaactgcaggtttgtcatcgaaa
ggtggacgtaataatcatggtcgtgttactgctcgttttcagggcggtggtcataaacgc
agttatcggtttgttgattttaaacgtcttaaacgtggtgtttttgcaaaagttgagcgt
ttggaatatgatccaaaccgcactgcttttattgctttaattcgttatgaagatgggcaa
ttaagttatattcttgcaccacaacgtcttgatgttggcgattctattatagcaggttca
aatgttgatgttaagccaggaaatgccatgcctcttggcaacatgccagtggggacgatt
attcataatgttgaaatgaaacctggaaaaggtggtcaaattgcccgttcagctggcact
tatgcgcagttggttggacggggtcagggaatggttattcttcgtcttaattctggtgaa
cagcggttggtatctggtagttgttttgcaactgttggtgctgtttcaaatcctgatcat
gcaaatattaatgatggtaaagcaggaaggtcacgttggcgtggcaagcgtccgcacgtt
cgtggtgttgctatgaatccagttgatcatccacatggtggtggtgaaggtcgtacctca
ggagggcgtcatccagtgtctccttggggtaagtctacaaaaggtaagcgtacgcgctct
aataaagccactgataaatttattatgcatacgcgtcatcagcgcaagaaatga

DBGET integrated database retrieval system