KEGG   Bartonella quintana RM-11: RM11_0784Help
Entry
RM11_0784         CDS       T02294                                 

Definition
(GenBank) 30S ribosomal protein S10
  KO
K02946  
small subunit ribosomal protein S10
Organism
bqr  Bartonella quintana RM-11
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    RM11_0784
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    RM11_0784
  Bacteria
    RM11_0784
  Archaea
    RM11_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(969916..970281)
Genome map
AA seq 121 aa AA seqDB search
MLKSAFVVKGALHNREIKSMNSQNIRIRLKAFDHRILDASTREIVSTAKRTGANVRGPIP
LPTRIEKFTVNRGPHIDKKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIK
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaagagtgcctttgttgttaaaggcgctttgcataacagggaaataaagagcatg
aacagtcaaaatatccgcattcgtttgaaggcgtttgatcacagaattcttgatgcatcg
acgcgtgagattgtgtcgacggctaagcgtactggcgccaatgtccgtggtcctattccg
cttccaacgcggattgagaagtttacggtcaatcgtgggccgcacatcgataagaagagc
cgtgagcagtttgaaatgcgtacacataagcgtcttcttgatattgttgatccaacgccg
caaacagtggatgcgcttatgaagctcgatctttctgctggcgtggatgttgagattaag
ctctaa

DBGET integrated database retrieval system