KEGG   Bartonella quintana RM-11: RM11_0786Help
Entry
RM11_0786         CDS       T02294                                 

Definition
(GenBank) elongation factor G
  KO
K02355  
elongation factor G
Organism
bqr  Bartonella quintana RM-11
Brite
Translation factors [BR:bqr03012]
 Eukaryotic Type
  Elongation factors
   RM11_0786
 Prokaryotic Type
   RM11_0786
Mitochondrial biogenesis [BR:bqr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RM11_0786
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    RM11_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(971526..973610)
Genome map
AA seq 694 aa AA seqDB search
MAREYKIEDYRNFGIMAHIDAGKTTMTERILFYTGKNHKIGETHDGASTMDWMEQEQERG
ITITSAATTTFWKGPDGRKRRFNIIDTPGHVDFTIEVERSLRVLDGAIALLDANAGVEPQ
TETVWRQAEKYRVPRMVFVNKMDKIGADFYRSVEMVGSRLGAKALVLQLPIGAENDFEGV
VDLVYMRALRWDGSIGAPATVSEIPSDLKEKAEEYREKLIEMAVEVDEAATESYLEGVMP
TDEQLVALIRKGTIEVQFHPVLCGTAFKNKGVQPLLDAVISYLPSPVDVPAISGIDVKTE
DEVTRESSDDAPLSMLAFKIMNDPFVGSLTFCRIYSGKVQKGISLENTVKKKRERLGRML
QMHSNSREDIEEAFAGDIVALAGLKETTTGDTLCDPLRPVVLERMEFPEPVIEIAIEPKT
KADQEKMGIALNRLAAEDPSFRVKSDEESGQTIIAGMGELHLDIIVDRMRREFKVEANIG
QPQVAYRESITKAAEIDYTHKKQSGGAGQFARVKIIFEPHDGDDFIFESKIVGGAVPKEY
IPGVQKGIESVMGSGPLAGFPMLGVKATLVDGGYHDVDSSVLAFEIAARAAFRDGAKKAG
AQLLEPIMKVEVVTPEDYVGDVIGDLNSRRGQISGTEARSVSTVVNAMVPLANMFGYVNS
LRSMSQGRAQYTMQFDHYEPVPSAVALEIQKKYA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgaatataaaattgaagattatcgtaattttggtattatggcgcatattgat
gccggtaagaccactatgactgagcgtattttgttctatactggtaagaatcataaaatc
ggtgagactcatgatggtgcttctacgatggactggatggagcaggagcaggagcggggt
attaccattacatctgctgcgacgacaaccttttggaaagggcctgatggtcggaagcgg
cgctttaacatcattgatacgccagggcatgttgattttacaattgaagttgagcgttct
ttgcgtgttcttgatggtgcaatagcattgctggatgcaaatgctggtgtagagcctcag
acagagactgtttggcgacaagctgaaaaataccgtgtgccgcgcatggtatttgttaat
aaaatggataaaataggtgctgatttttatcgtagcgtggaaatggttggttcgcgattg
ggggctaaagcactcgttttgcaattgccaatcggtgctgaaaatgatttcgaaggcgtc
gttgatcttgtttatatgagggcattaagatgggatggttctatcggtgctccagcgacg
gttagtgaaattccttcagatttgaaggagaaggctgaagaatatcgcgaaaaattaatt
gagatggcagttgaggttgatgaagccgcaacagaatcttatttggaaggtgtgatgcca
accgatgaacagcttgttgctctcattcgtaagggaaccatagaggttcagtttcatcca
gtcctttgtggtacagcttttaaaaataagggagttcaaccacttttggatgctgttatt
tcttatcttccttctccggttgatgttcctgcaattagtggtattgatgtgaagactgag
gatgaagtaacacgtgaatcttcagatgatgctccactttctatgcttgcttttaagatt
atgaatgatccttttgttgggtcgttgactttctgtcgtatttattctggtaaagttcaa
aaaggtatttctcttgagaatactgtgaagaagaagagggagcgtttgggccgtatgctt
caaatgcattcaaactctcgtgaagatattgaagaggcttttgcgggtgatattgttgct
ctcgcaggacttaaagagacgacaacaggtgatactctttgtgatcctttaaggcctgtt
gttctagaacggatggagttcccggagcctgttattgaaattgcgattgagccaaaaaca
aaggcggatcaggaaaaaatgggtattgcgcttaatcgtttagcagcagaagatccttcg
tttcgtgttaaatcagatgaggaatcaggtcaaacaattatagctggaatgggtgagctt
catcttgatattattgttgatcgtatgcgacgtgagtttaaggttgaggctaatattggg
cagcctcaggttgcttatcgtgaatcgattacaaaagctgcagagattgactatacgcat
aagaagcaatctggtggtgcagggcaatttgctcgtgtgaaaattatttttgaacctcat
gatggtgatgatttcatctttgagtcaaaaatcgttggtggagctgttccaaaagaatat
attccgggtgttcagaaggggattgagagcgttatggggtcaggtcctcttgcaggtttt
cctatgcttggtgtaaaagctacattggtcgatggtggttatcatgatgtcgattcttct
gttttggcttttgagattgctgcccgtgcggcttttcgagatggggcgaaaaaggcaggc
gcgcagcttcttgagccgatcatgaaggtggaggttgttacgccagaagattatgttggt
gatgtcattggtgatttgaattctcgtcgaggtcaaatttcaggaactgaggcgcgttct
gtttcaacagttgtgaatgcaatggttcctttggcaaatatgtttggttatgtgaacagt
cttcgttcgatgagtcagggacgtgcacagtatacaatgcagtttgatcattacgagcct
gtcccttccgctgttgctttggagattcaaaagaaatacgcgtaa

DBGET integrated database retrieval system