KEGG   Bartonella quintana RM-11: RM11_0792Help
Entry
RM11_0792         CDS       T02294                                 

Definition
(GenBank) amino acid permease
  KO
K10002  
glutamate/aspartate transport system permease protein
Organism
bqr  Bartonella quintana RM-11
Pathway
ABC transporters
Two-component system
Module
Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RM11_0792
  Signal transduction
   02020 Two-component system
    RM11_0792
Transporters [BR:bqr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    RM11_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
977756..978472
Genome map
AA seq 238 aa AA seqDB search
MINFITSQFGFSSLFNFLDFDFSFFTFDIFCSYILSGLLFSVFLTLFATILGLIFGTLLA
MMRLSSMKLLSWLAVIYIIAMRSIPLVMVILWFFVLLPFLTGTSIGVNKSALITFTAFEA
AYFAEIMRAGINSVSQGQKHAGQALGMTYWQNMYIVILPQAFRDMLPVFLTQVIILFQDT
TLVYAISGNSLLNGFDIVANNFGVKQEAYILAAIFYFVICFTLSQIVLYLQKKISIIR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgataaatttcataacctcccagtttggattttcttctcttttcaattttttagacttt
gatttttcattttttacttttgatatattttgttcttacattctttcaggtttactcttt
agcgtttttctaactctttttgcaacgatattgggacttatttttggcacgcttttagcg
atgatgcggctttcttctatgaaactactctcttggcttgcagtaatttatataattgcc
atgcgctcaataccgcttgttatggttattttatggttttttgtgcttttacctttcctg
actggcacgtcaatcggtgtaaataaatcagcactcattacctttactgcatttgaagct
gcttattttgctgaaattatgcgtgctggcattaattctgtttcacaaggacaaaaacat
gcgggacaagctcttggaatgacatattggcaaaatatgtacattgtaattcttccccaa
gcttttagagacatgttgccagtttttttaacccaagttattatcctctttcaggataca
acgcttgtttatgcaatcagtgggaatagccttttgaatggttttgatattgttgctaac
aattttggtgtgaagcaagaagcctacatcttggcagctattttttattttgttatttgt
tttacactatcgcagatagttttatatctacagaaaaaaatatccattattcgttaa

DBGET integrated database retrieval system