KEGG   Bartonella quintana RM-11: RM11_0793Help
Entry
RM11_0793         CDS       T02294                                 

Definition
(GenBank) glutamate/aspartate transport ATP-binding protein
  KO
K10004  
glutamate/aspartate transport system ATP-binding protein [EC:3.6.3.-]
Organism
bqr  Bartonella quintana RM-11
Pathway
ABC transporters
Two-component system
Module
Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RM11_0793
  Signal transduction
   02020 Two-component system
    RM11_0793
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     RM11_0793
Transporters [BR:bqr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    RM11_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
978521..979255
Genome map
AA seq 244 aa AA seqDB search
MIEIKNVSNWYGEINILKNCTTNINKGEVVVVCGPSGSGKSTLIKTINALVPFQKGEIWI
DGVPVHSKKTNLSKLRSHVGMVFQHFELFPHLSVTENLTIAQIKVLKRSKKEALERGLLY
LERVGLTEHKNKYPGQLSGGQQQRVAIARALTMDPLVMLFDEPTSALDPEMVGEVLDVMI
SLAEEGMTMICVTHEMGFAQKVSERVIFMDQGRILEDCSSKEFFSVPQARTPRAQEFLSK
ILNH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaataaaaaatgtctcaaactggtatggcgaaattaatattcttaaaaactgt
acaaccaatatcaataaaggagaagttgttgtagtttgtgggccatcaggttcaggtaaa
tcaacgctcattaaaactattaacgctttagtacctttccaaaaaggtgaaatttggatt
gatggagtaccggttcattcgaaaaagacaaatctgtctaaattgcgtagccacgtaggg
atggtatttcaacatttcgagcttttccctcatttatctgtcacagaaaatttaacaatt
gcacaaatcaaagttctaaaacgtagcaagaaagaagcacttgaacgcggcttgttatat
cttgaacgcgttggacttactgaacataaaaataaatatcccggccaactttccggaggt
caacaacaacgtgttgcgattgcacgcgccttaactatggatccactcgttatgcttttt
gatgagccaacatctgctctagatcctgaaatggtaggtgaagtactagatgtcatgatc
agcttagcagaagaaggtatgacaatgatttgtgtcacgcatgaaatgggatttgctcaa
aaagtctcggagcgtgttattttcatggatcaaggaagaattctcgaagactgttcatcc
aaagaattcttttctgtcccacaagccagaacaccacgtgcccaagaatttttgtctaaa
atcctcaaccattaa

DBGET integrated database retrieval system