KEGG   Bartonella quintana RM-11: RM11_0795Help
Entry
RM11_0795         CDS       T02294                                 

Definition
(GenBank) hypothetical protein
Organism
bqr  Bartonella quintana RM-11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(983580..984116)
Genome map
AA seq 178 aa AA seqDB search
MDEILTSIREIIEENAVHPNNFSNQGVTVNASTECSTGPSEGIYDTTLSVDDAMKALADR
IGLSSENQDFPLMQDKDNTEAENNTVGVDMQKIKLSSEEQRSVHKTKEYGDKAFISQPEN
ITAGHVELELPAYCISSAEKIAKDVLRPAIAEWLQCKLPVLFEDILREEIVKAIKKSS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaattttgacatctattcgcgaaataatcgaggagaatgcagttcatcctaat
aacttttcaaatcaaggcgttacggtgaatgcttctacagagtgttcaacagggccctca
gaaggtatttatgatacaaccttatcagttgatgatgcgatgaaagctctcgctgatcgt
atcggtctttcttctgaaaaccaggattttcctttaatgcaagacaaagataatacagag
gcagaaaacaatacggtcggcgtagatatgcaaaaaataaagctttcttctgaagaacag
cgctctgttcataaaacaaaagaatatggtgataaggcatttatatcacagccagaaaat
ataactgcgggccatgtagaactagaactgcctgcatattgtatttcttctgcggagaag
attgcaaaggacgtgttgcgtccagctatagcagaatggttacagtgtaaattacctgtt
ttgtttgaagatattttacgtgaagagatcgttaaggcaattaagaagtcatcttaa

DBGET integrated database retrieval system