KEGG   Bartonella quintana RM-11: RM11_0800Help
Entry
RM11_0800         CDS       T02294                                 

Definition
(GenBank) hypothetical protein
Organism
bqr  Bartonella quintana RM-11
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
987966..988187
Genome map
AA seq 73 aa AA seqDB search
MLFSPALIQTNKKSKRETYSKRTILSEYFTQAAFFADLQEQKDLTLFAAAFAFLYLSFED
EEFLPCDCAALSL
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
ttgcttttttctcctgctctcattcaaactaacaagaaatcgaaaagagaaacatattct
aagcgcacgatcttatctgaatattttactcaagctgccttctttgctgatctgcaggaa
caaaaagacttgacactctttgctgctgcttttgcttttttatatctttcatttgaagac
gaagaatttctaccctgtgactgtgcagcattatctttgtga

DBGET integrated database retrieval system