KEGG   Bartonella quintana RM-11: RM11_0806Help
Entry
RM11_0806         CDS       T02294                                 

Definition
(GenBank) bifunctional preprotein translocase subunit SecD/SecF
  KO
K12257  
SecD/SecF fusion protein
Organism
bqr  Bartonella quintana RM-11
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    RM11_0806
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    RM11_0806
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RM11_0806
Secretion system [BR:bqr02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   RM11_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
994656..997169
Genome map
AA seq 837 aa AA seqDB search
MRTPGWLTTLYCFILLSSIYIALPNLFSQEQVKNSRFLTDTRVTLGLDLQGGSSLLLEVE
AKTLKRDQLHMLLSNVRNTLREKQIRTSSIRVLEDSVVALISDPKESEKALSALKTLITP
IHNSFGSKANDITISAQDNTLRIMLTEAGMKERISNAIEQSLEIIRRRIDQVGVTEPAIQ
KVGTDRIMVQLPGLQDPKQLRDLLGTTAKMTFHLVPSNVDINNLPAGVSILPGYTDKTQR
YAIYDQIALDGNVLKDARAGFDPQMPGRSIISFTMNSIGSKIFADITRQNINRPFAIVLD
NKVLTAPIINSVIPNGQGQITGNFDPKEASTLAALLRAGSLPAPLTVIEERTVGPNLGAD
AIQMGLYTGIIGFVLVTVFIFLLYGIWGIIANIALALHTILTFAALSLLGATLTLPGIAG
IILGIGIAVDANILINERIREESRKGISAFAALDRGFKQAFATIVDANITAIIATILLFW
FGTGPVRGFAVTMLLGIIISMFTNITIVRIMMIWVVRKWKIKTLHFRSIFNITPQNTTFR
FMKARFIGISVSIILSLVSVFLFLKPGLNFGIDFIGGSQMSITTKAPANLATLRSKLSTL
NIGEVTLQNIDNANTVLIRIQKQSGGATQQTAAIDKVKTAVQNIYPNTTFDQIEVVGPKI
SGELATAAFTAVILAAIAMSLYIWLRFEWFFAVGAIVTLILDTTKMIGFFALFQFDFNLT
AIAALLTIVGYSINDKVVVYDRMRENMRLYKNMPLRELIDFSINQVLIRCLFTSATTVLA
MLPMAIWGGSAVHNFAVPMVFGIIIATSSSIFIAAPILLLLGNWWRKRNNRTNTKLK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacacccggttggttgactactctttattgttttatccttttaagcagcatttac
attgccttgcccaatttattttcgcaagaacaagttaaaaattcaagattcttaactgat
acccgtgtgacacttggacttgaccttcaaggaggatcttctctcctcctcgaggtcgag
gccaaaacactaaaaagggatcaactacacatgcttctaagcaatgtgcgtaacacactg
cgtgaaaagcaaatccgtacatcgagcattcgtgtcctcgaagatagcgtagttgctctt
atttccgatccaaaagaaagtgaaaaagcactctctgctttgaagacattgatcacacct
atacacaacagctttggaagtaaagccaatgatatcacgatcagtgctcaagataacact
ctccgtataatgttaaccgaagctggtatgaaagaacgtatcagtaatgctattgagcaa
agcttggaaatcatccgtcgccgtatagatcaggttggtgttactgaaccagccatccaa
aaagtaggaactgatcgtattatggttcaattgcctggtctacaagacccaaagcagtta
cgcgatcttttaggaacaaccgctaagatgacctttcatcttgtgccctccaacgtggat
ataaataacttacccgcaggtgtttcaatccttcctggatacactgataagacacaacgt
tatgcaatttatgaccaaatcgccttggatggcaatgtcctaaaagatgcccgtgcaggt
tttgatccgcaaatgccaggacgttctattatttcattcaccatgaattctattggttca
aaaatatttgcggatataacacgacaaaatattaaccgtccttttgcaatcgttcttgat
aacaaagttttgactgctcctatcatcaacagtgttattcccaacggacaaggccaaatt
acaggaaattttgatcccaaagaagcatcaactctggctgctctcctgcgcgctggttcc
ttgcccgccccactcacggtgattgaagagagaactgtaggtccaaatcttggtgctgat
gctattcaaatgggactttacacaggcattattggctttgttcttgttacagtttttatt
tttcttctctatggaatttggggtatcattgcgaatatagcgctagcattacacactatt
ttaacatttgccgcgctaagtcttctcggtgctacactcacactaccgggtattgctggt
attattttaggtatcggtatcgccgttgatgccaatattctaatcaatgagcgtatccgt
gaagaaagccgtaaaggtatcagcgcctttgctgccttagatcgtggattcaaacaggct
ttcgcgaccattgttgatgctaatattactgcaattattgcaactattttattgttttgg
tttggcaccggtcctgttcgcggttttgctgtaacaatgttacttggtattatcatctcc
atgttcacgaatattaccattgtgcgcatcatgatgatttgggtcgttcgtaaatggaaa
attaaaactctgcattttcgctctattttcaatattaccccacaaaatacaactttccgc
tttatgaaagcgcgcttcatcggtattagcgtctcaattattttatcacttgtttcagtt
tttctgtttttaaaacctggcttgaatttcggaattgatttcattggcggcagccaaatg
agtatcaccacgaaagctccagcaaatttagcaaccttacgttcaaagctttctaccctt
aacataggtgaagttacgctacaaaatatagataatgcaaacaccgtgctgatccgcatt
cagaaacaaagtggtggtgcaacacaacaaaccgctgccattgataaggtcaaaacagca
gtacaaaacatttatcccaatactacattcgatcaaatagaggttgttggccccaaaatt
tcaggcgaacttgctacagctgcctttactgctgttattctcgcagcaattgccatgtcc
ctctatatatggttacgcttcgaatggttttttgcagttggagcaattgtaacgctcatc
ttagacaccacaaaaatgattggtttttttgctttgtttcaatttgatttcaatttaact
gccattgccgctcttttaacgattgttggttattccataaacgataaggttgtagtctat
gatcgaatgcgcgaaaatatgcgcctttataaaaacatgcccttgcgtgaactgattgat
ttctcaattaatcaagtccttatacgctgtctctttacatcagcaaccacagttctcgct
atgctccctatggcgatatggggcggaagtgctgtccataattttgcagttcctatggtc
tttggaattattattgcaacatcatcttcgatctttatcgccgctcctattttactatta
ctcggaaattggtggcgtaaacgaaacaaccgtacaaacactaaactaaaatga

DBGET integrated database retrieval system