KEGG   Bartonella quintana RM-11: RM11_0812Help
Entry
RM11_0812         CDS       T02294                                 

Definition
(GenBank) D-serine/D-alanine/glycine transporter
  KO
K11737  
D-serine/D-alanine/glycine transporter
Organism
bqr  Bartonella quintana RM-11
Brite
Transporters [BR:bqr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   RM11_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1004786..1006189
Genome map
AA seq 467 aa AA seqDB search
MNCKQNLEENLQNKLQRGLDNRHVQLIAIGGTIGTGLFMGSGKTISVAGPSIILVYAIIG
CALYFVMRAMGELLLSNSQYRSLIDFSTDILGPGIAFFAGWSYWLSWVVTGAADIIAIIT
YMHFWWPTLNPWIIVFACVTFFLTLNLLAVKMFGELEFWFGLIKVVAILALIIVGFYMIA
TGFTSPNGTVASLSHIWNDGNIFPRGITGFFAGFQIAIFSFVGIEIAGTAAAEVKEPKKV
LPKAINAIPIRIVLFYIFSLVVIMSVTPWDQVIPDKSSFVTMFWLAGIPTAAGLVNFVVL
TSAASSANSGIFSTSRMIYGLATQKGAPRLLGKLSNHHVPANALFFSCLCILLGYTIASL
SPNIINAFTIVTSISAISFIFVWSVILVSYIVYRRNRPQLHIESIYKMPGGVIMCWIILA
FFAFILYLLTLEPDTLIAFKYSLLWFIFLGVTYFIMFVRKKTAQHTK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtaaacaaaatttagaagaaaatcttcagaataaactgcaacgtggcctcgat
aaccgccatgtacaacttatagctattggtggtactattgggacaggactcttcatggga
tcaggaaaaacaatcagtgtagcaggcccttccatcatactcgtttatgctattatcggt
tgtgctctatactttgtaatgcgcgctatgggagaattattgctttccaactcacaatac
cggtcacttattgatttttcaaccgatatactaggaccaggaattgctttttttgccggc
tggagctattggttgagctgggttgtgactggagctgcagatattattgctatcatcact
tatatgcacttttggtggcccacacttaatccatggatcatcgttttcgcttgcgttacc
ttctttttaacccttaatctccttgctgtaaaaatgttcggtgaacttgagttttggttt
ggtctcatcaaagtcgtagcaattttagcattaatcattgttggattttatatgatcgct
actggctttacctccccaaatggtactgttgcctctctcagtcacatatggaacgatgga
aatatctttcctcgtggaattacaggtttttttgctggatttcaaatagccattttttct
tttgttggtatagaaattgctggaacagctgcagctgaagtcaaagaacctaaaaaagtt
ctaccaaaagcaattaatgcaatacctattcgtattgtactcttttatattttttctctc
gttgtgattatgtcagtcacaccttgggatcaagttatcccagataaaagttcctttgtc
acaatgttctggcttgctggcattccgacagctgctggtttggtgaattttgttgttctc
acatcggctgcctcttcagcaaatagtggtattttttctaccagccgcatgatatatggg
cttgcaacgcaaaaaggtgctcctcgccttttgggaaaactttcaaaccatcatgttcca
gccaacgccctattcttttcttgcttatgtattttattagggtacacaattgcatcactc
tctccgaacatcataaatgcttttacaattgttaccagcatttcagctatctcatttata
ttcgtatggtctgtaattttggttagctatattgtgtatcgtcgcaatcgccctcagcta
catattgaatccatctacaaaatgccaggaggtgttatcatgtgctggattattttagcc
ttctttgccttcattctctatttgctaacattagaacctgatactctaatagcttttaaa
tacagtctattatggtttatttttttaggcgtaacgtatttcattatgtttgtaagaaaa
aaaacagctcaacatacaaaataa

DBGET integrated database retrieval system