KEGG   Bartonella quintana RM-11: RM11_0817Help
Entry
RM11_0817         CDS       T02294                                 

Definition
(GenBank) tRNA delta(2)-isopentenylpyrophosphate transferase
  KO
K00791  
tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
bqr  Bartonella quintana RM-11
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:bqr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     RM11_0817
Prenyltransferases [BR:bqr01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   RM11_0817
Transfer RNA biogenesis [BR:bqr03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    RM11_0817
 Prokaryotic Type
    RM11_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(1013300..1014187)
Genome map
AA seq 295 aa AA seqDB search
MTQRTITLIAGPTVSGKSALALQMAQKKNALIINTDSMQVYDVLNILTARPTEADTAIVP
HYLYGYVSPALHYSVGQWLCDVRKLLTTFTSKSLIFVGGTGLYFRALLEGLSEIPHISDT
VRQKWRLRLDKEGAENLYRQLLRIDAVFAEKISSQDGQRIIRALEVYDVTGKKLSWWQKK
KTPPLISPNCSEKILLIPPRQWLYERIHKRLDNMIERGALEEVFAMKKLMLSPFLPAMKA
IGMPEFTAYFDGYKSFEDALETAKTQTRRYAKRQMTWFRNQFDEEWTLISSCEEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacacagagaacgattacgttgatagctgggccaactgtaagtgggaagtcagcgctt
gctttgcaaatggctcaaaaaaaaaatgctcttatcattaacactgattcaatgcaggtt
tatgatgttttaaatattttaacggcacggccgacggaagctgatactgccattgttcca
cactatctctacggttatgtgagtccggctcttcactattcagtgggacagtggttatgt
gatgttaggaagcttttaacgacattcacctcaaaatcacttatttttgttggcggaaca
gggctttattttcgtgctcttttggaagggctttcggaaatccctcatatttcagatact
gtgcggcagaaatggcgacttcggcttgataaagaaggagctgaaaacctttatcgccag
ttattgcggattgatgctgtttttgctgagaaaatttcttcacaagatggccagcgtatt
atacgtgctctggaagtttatgatgtcacaggtaagaagttaagctggtggcagaagaaa
aaaacacctccgctgatttcgccaaattgttcagaaaaaattcttcttattccaccacgt
caatggctttatgagcgtattcataagcggttggacaatatgattgaaagaggagcttta
gaagaggtgtttgctatgaagaagcttatgctttccccttttttaccagcgatgaaggct
attggcatgcctgaatttacagcttattttgatggatataaaagttttgaggatgctctt
gaaacggcgaaaacgcaaacgaggagatatgcaaaaaggcaaatgacctggtttcgtaat
caatttgatgaagaatggacgctcatttcttcatgtgaagaggtgtag

DBGET integrated database retrieval system