KEGG   Bartonella quintana RM-11: RM11_0823Help
Entry
RM11_0823         CDS       T02294                                 

Definition
(GenBank) Alpha-ketoglutarate permease
  KO
K03761  
MFS transporter, MHS family, alpha-ketoglutarate permease
Organism
bqr  Bartonella quintana RM-11
Brite
Transporters [BR:bqr02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    RM11_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1020232..1021539
Genome map
AA seq 435 aa AA seqDB search
MEKEAVLAPYDTKKRVLSIISSASGNLVEWYDFYVYSFTSIYFASQFFPSDGDVVTELLK
SSVVFFIGFLMRPIGGWLFGFIADRYGRKRSLLISVFMMCGGSFLIALLPTYETIGATAA
VLLILLRMVQGLSVGGEYGTTATYMSEIALKNRRAFFSSFQYATLIGGQLLASLVMFILA
LYLTEDQLKAWGWRIPFAIGGLGAIVAIYLRRSLHETTTKESRSQQQAGSLIGLLRNHKK
AFFLVIGFTAGGSLTFYTYTTYMQKYLITTSGFDKHTATTIMTAALFVFMLLQPLFGSLA
DRIGPKTSLLIWSVLSILFTIPGLRLIGNTSNTWSALLIVIGMLCIMSFYTSVSGIVKAE
MFPASIRAMGVGLSYAIANALFGGSAETVALEFKKIGYESVFHFYIVGMMVIAFIAILLM
PNARKKGYLQGDDIY
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggaagcagttttagcaccatatgatacaaagaaacgtgttctctctatcata
tctagtgcatcaggtaatctggtagaatggtatgatttttatgtttactcttttacatcc
atctattttgcatcacagttttttccctccgatggagatgttgttaccgaacttttaaag
tcttccgttgtcttttttattggctttcttatgcgccctattggcggctggctgtttgga
tttattgccgatcgttatggacgtaaacgctctttacttatttctgtttttatgatgtgc
ggtggttcgttcctcattgcccttcttcccacctatgaaactattggagcaacagcagca
gttctgctcattttactccgtatggttcaagggctctcagtcggcggtgaatatggcaca
acagcaacttatatgagtgaaattgctctcaaaaatcgtcgtgctttctttagctctttc
caatatgccacactcattggtggtcaacttcttgccagtctggttatgtttattctagca
ctttacctcactgaagatcagttaaaagcatggggctggcgtattccttttgcgattggt
ggactaggagcaattgttgcaatttacctccgtcgttcgcttcatgaaacaaccacaaaa
gaaagccgttcccaacaacaagcagggagtcttataggattgctgcgaaatcacaaaaaa
gccttttttctggttattggctttacagctggaggatccctcacattttacacatacact
acttatatgcaaaaatatctgatcacgacgtccggatttgataaacacactgcaacaacg
ataatgactgctgcactctttgtttttatgttacttcaacccctatttggttctctggcc
gatagaattggaccaaaaacttcattgcttatttggagtgtcttatccatcctttttaca
attcctggtcttagactaattggtaacacttctaatacctggagtgcactattaatcgtt
attggaatgctctgtattatgagtttttatacgtccgtctctggtatcgtaaaagcagaa
atgtttcctgcttcaatacgcgcaatgggagttgggctctcttatgctatcgcaaatgca
ttatttggtggttctgctgaaactgtagcactcgaatttaaaaaaatcgggtatgaatct
gtcttccatttttacatagttggtatgatggtcattgcattcattgcaattcttcttatg
ccaaatgctcgaaaaaagggatacctgcaaggggatgatatttattaa

DBGET integrated database retrieval system