KEGG   Bartonella quintana RM-11: RM11_0827Help
Entry
RM11_0827         CDS       T02294                                 

Definition
(GenBank) DNA helicase II
  KO
K03657  
DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
bqr  Bartonella quintana RM-11
Pathway
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    RM11_0827
   03430 Mismatch repair
    RM11_0827
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RM11_0827
DNA repair and recombination proteins [BR:bqr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     RM11_0827
   MMR (mismatch exicision repair)
    Other MMR factors
     RM11_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1025997..1028492
Genome map
AA seq 831 aa AA seqDB search
MHSRVFSLTIFSIRFIFSFLRSLSPHSTEGVVASLRKVFLDLALKSKKDYTKGTMNNFFD
HIPFFEDESPPHKHENNPGLTAHAVSTKEKTRCDTNYLETLNPEQRQAVINTEGPLLVLA
GAGTGKTRVLTTRISHILRSGLASPKQILAVTFTNKAALEMKMRIGELIGEIVEGMPWLG
TFHSTGAKILRRHAELVDLKTNFTILDNDDVIRLLKQLIQAEGLDDKRWPARCFAMMIDS
WKNQGLSPERISESDAYSFGNGMGRKLYCSYQNRLKSLNACDFGDLLLHCISIFQNNPDI
LHDYHSKFRYILVDEYQDTNTAQYLWLRLLAQQPKGQHVNLCCVGDDDQSIYGWRGAKVD
NILRFEKDFPPAKIIRLERNYRSTSHILKTASHLISHNQGRLGKVLFSDQINIEEEKVKI
HAAWDSQKEARAIGEEIEQAQQAGHSLNHIAILVRASFQMREFEDWFVTLGLNYRVIGGP
RFYERMEIRDALAYLRVVVQPADDLAFERIINTPKRGLGDATLRTLYESARARDIPLFTA
AAEIIKTDELKPKARTALRSIVENFHRWQNMLQYTPHRELAEIVLDDSGYTTMWQEDRSP
EAPTRLENLKEMIRSMEQFESLHSFLEHVALIMDAENNENTDAVNIMTLHSAKGLEFETV
FLPGWEEGLFPHQRSLDENGRSGLEEERRLAYVGLTRAKKYLHIWFVSNRRIHGLWQSTL
PSRFLDELPKEHIEVVEMETSYGDYGKSHFKHHTPFYSDYSTPGWERAQKNIEGKIAQSV
FQTPSDFSINDRIFHIKFGYGYISAVDGHKLTIVFEKAGEKQVLDNFVSKA
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgcactccagagtattctctctcaccatctttagtattcgttttatcttttcttttttg
cgatctctgtctcctcattcaaccgaaggtgttgtggcttccttgagaaaagttttttta
gatctagcgctcaaatcaaaaaaagactacacaaaaggtacaatgaataacttttttgat
cacataccatttttcgaagatgaatcccctccccataagcatgaaaataaccctgggtta
accgcccatgctgtaagtacaaaagaaaaaacacgatgtgacactaattatttagaaaca
cttaacccagaacaacgacaagccgtcataaatacagaagggcctcttttagttcttgcg
ggtgctggtactggaaaaacacgtgttctcactacccgcatttctcatattttacgctct
gggcttgcttcccctaagcaaatactcgctgtaaccttcaccaacaaagcagcgctcgaa
atgaaaatgcgtattggtgaacttattggtgaaattgttgaaggcatgccttggcttgga
acttttcattccactggtgcaaagattttgcgccgtcacgcagaacttgttgacttaaaa
accaattttacaattcttgataacgatgatgttattcgtcttttaaaacagcttattcaa
gctgaaggattagatgataagcgttggccagcacggtgttttgcaatgatgattgattct
tggaaaaaccaaggactttctccagaacgtatttcagaaagtgatgcctattccttcggt
aacggcatgggccgtaaactttattgcagctatcaaaatcgattaaaaagtctcaatgct
tgtgatttcggcgaccttttgcttcattgtatctctatctttcaaaacaacccagatatt
cttcacgattatcattccaaattccgctatattctcgtagatgaatatcaagatacaaat
acagcgcaatatctttggcttcgccttttggcgcaacaacccaaaggacaacatgtgaac
ctttgctgtgttggtgatgatgaccaatctatttatggatggcgtggcgcgaaagtcgat
aacatattacgttttgagaaagatttccctcctgcaaaaattattcgtctagaacgcaat
tatcgctcaacatcccatattcttaaaaccgcttctcatctgatttctcataaccaagga
aggcttggaaaagtacttttttctgatcaaataaatattgaagaagaaaaagtaaaaatt
cacgcagcatgggattcgcaaaaagaagcgcgcgccatcggagaagaaattgaacaagcg
caacaagctggtcattcattaaaccatatagctatattggtgcgtgcatcatttcagatg
cgtgaatttgaagattggtttgtaacacttggtctcaattaccgcgtcattggtggacca
cgtttttatgaacgaatggaaatacgtgatgccttagcttatttacgcgttgtagtccaa
ccagctgatgatttggcttttgaacgcattatcaacacacctaaacgtggcttaggagat
gcaactttacgcaccctttatgagagtgcacgggcacgagatattcctctctttactgct
gctgctgaaataattaaaacggatgagttaaaacccaaagcacgtactgctttgcgaagc
attgtcgaaaattttcaccgctggcaaaatatgctgcaatacacaccccatagagagctt
gcagaaatagtcctagatgattccggctacacaaccatgtggcaagaagatcgctcacca
gaagcaccaacgcgactagaaaatctcaaagaaatgatccgctctatggaacaatttgaa
agccttcatagctttttagaacatgttgcactgattatggatgctgaaaacaatgaaaat
accgatgcggttaacatcatgactctgcattcagccaaagggcttgaatttgaaacagtt
tttcttcctggttgggaagaaggactctttccccatcaacgctccttggatgaaaatggc
cgttcaggattagaagaagaacgacgactagcttatgtagggctgacaagagcaaaaaaa
tatctgcatatatggtttgtatccaatcgaagaattcatggactttggcaatctacgctt
ccttctcgttttcttgatgaattaccaaaagaacatatagaagtcgtagaaatggaaaca
tcttatggtgattatgggaaatcgcattttaaacatcacactcccttttatagtgattat
tcaacaccaggatgggagcgtgcacaaaaaaacattgaaggaaaaattgcccaatcggtc
tttcagacaccctcagatttttcaatcaatgatcgtattttccacatcaaattcggttat
ggctatatctcagcagtcgatggtcataaattaaccattgtgtttgaaaaagctggagaa
aagcaagtactcgacaattttgtaagcaaagcttag

DBGET integrated database retrieval system