KEGG   Bartonella quintana RM-11: RM11_0828Help
Entry
RM11_0828         CDS       T02294                                 

Definition
(GenBank) sco1/2 family protein
  KO
K07152  
protein SCO1/2
Organism
bqr  Bartonella quintana RM-11
Brite
Mitochondrial biogenesis [BR:bqr03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    RM11_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1029259..1029840
Genome map
AA seq 193 aa AA seqDB search
MKNVIRILGITIIFLASIFIYDAFKNKPLGDNFTLIDSNGKTITEVDIRSKPSIVFFGFT
MCPESCPTTLTNLDRWLTELGPNADKLGVWFVTVDPERDTPEVLHEYLSNFTNKIIGISG
DPEQVHKMVDSFNIVAEKVPGADGSYTYNHTAAIFLLKKGGKLAGVIPYKIEENNDELKD
NIAIERFKKLISN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgtcatacgtatcttaggaataacaatcatatttcttgcaagcatttttatt
tatgatgcatttaaaaataaacccttaggtgataattttacactcattgattctaatgga
aaaactatcacagaggttgatattcggagcaaaccttcaatagttttctttggtttcact
atgtgccctgagagctgccctactacattgactaatcttgatcgatggcttacagaactt
ggcccaaatgcggataagttaggagtatggtttgttactgttgatcctgaacgtgacaca
ccagaagtacttcatgaatatcttagtaattttacaaataaaattattgggatcagtgga
gatcctgaacaagttcataaaatggtagattctttcaacatcgttgctgaaaaagtacct
ggagcagatggaagctatacttataatcatacagcagcaatttttttattaaaaaaaggt
ggaaagttagctggcgttattccttataaaattgaagaaaacaacgatgaattaaaagat
aatatcgccattgaacggtttaaaaaacttatctcaaattaa

DBGET integrated database retrieval system