KEGG   Bartonella quintana RM-11: RM11_0830Help
Entry
RM11_0830         CDS       T02294                                 

Definition
(GenBank) aminopeptidase p protein
  KO
K01262  
Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
bqr  Bartonella quintana RM-11
Brite
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     RM11_0830
Peptidases [BR:bqr01002]
 Metallo Peptidases
  Family M24
   RM11_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1030759..1032585
Genome map
AA seq 608 aa AA seqDB search
MYQSFEAITNPAYAAERIYSLRKELDRLGLDGFLVPRADEHQGEYVPLHAQRLSWLTGFT
GSSGIALILKNKAIIFTDGRYKLQVRQQTDPLIFEYEDLMTYPPSQWLEKNGQKLSIGFD
PWLHTIAATTALRKALEMKANGKLVAIQKNPIDLIWHNQPQPPQSALSIHPLKYAGCNSD
EKLILIRQDIQKANADAFIFTDPSSIAWIFNIRGNDVSNTPFALCFALIPLKETPVLFID
RKKIGEEQKRYLEHYAKLYEPEQLILTIKDYVQKGMIFALDPRITCEKLHIAIKEKRGSF
ITLTDPAALPRAVKNNIELSGARKAHLRDGVALIRFFSWLDKQTPGTTNEISAAQKLEEF
RIMTAKEMGEKLEDLSFDTISAAGANGAIVHYRVTTQTNKQLNAGELYLIDSGGQYRDGT
TDVTRTVAIGDVGTEEKRCFTLVLKGMIALSTARFPQGTRGQDIDVLARIALWKAGFDYA
HGTGHGVGSYLSVHEGPQNLSRNGSQELIPGMILSNEPGYYREGAFGIRIENLMIVKPAQ
KINGGDIEMLSFETLTNCPIDCRLILPELLTPQERQWLNDYHAHVYHINASYLNEDDKKW
AKKATMPL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatcctttgaagctataacaaatccagcttatgctgcagaacgtatttactct
cttcgtaaagaacttgatcgccttgggctagatggttttcttgtaccacgtgcggatgaa
catcaaggagaatatgtccccctccatgctcaacgtcttagctggctcactggctttact
ggatcatctggtatcgcacttattttaaaaaacaaagctatcatcttcacagatgggcgt
tataagctccaagttcgccaacaaactgatcctcttatttttgagtatgaagatctcatg
acgtatcctccttcgcaatggcttgaaaaaaatgggcaaaaactttctattggttttgat
ccatggctccacaccattgccgctacaactgcattgagaaaagctttagaaatgaaagca
aatggcaaacttgtagcaatccaaaaaaatcccattgatcttatctggcataatcaacca
caacctccgcaatctgccttatcaattcaccctctcaaatatgcagggtgcaatagcgat
gaaaaactgatcttaatccgccaagatatccaaaaagctaatgcagatgcttttattttt
acagatccctcctctattgcatggatattcaatatacgtggtaatgatgtttccaacaca
ccttttgctctttgttttgctctcattccactcaaagaaacaccagtcttattcattgac
agaaaaaaaattggtgaagaacagaaacgatatctagaacattatgcaaaattatatgaa
ccagaacaactgattctaacaatcaaagattatgttcaaaaaggaatgatttttgcctta
gatccacggatcacatgcgaaaaattacacattgctattaaagaaaaaaggggctctttc
attacgcttactgaccccgctgccctaccacgtgctgttaagaataacatagaattaagc
ggcgcacgcaaagcacatctgcgtgatggcgtagcacttatccgttttttttcttggtta
gataaacaaacaccaggtacaacgaatgaaatttctgctgctcaaaaattagaagaattt
cgcataatgacagcaaaagaaatgggagaaaaacttgaagatctgtcttttgatacaatc
tcagcagcaggtgcaaatggtgcaattgtccattatcgtgtaacgacccaaacaaataaa
caactgaatgctggtgaactttatctcattgattcaggtggacaatatcgtgatggtaca
acagatgttacgcgcacagtggcaattggggatgttggaacagaggaaaaacgctgtttt
actcttgttctcaaaggcatgattgctctttcaaccgcacgatttccacaaggcactcgc
ggacaagatattgatgtcctagcacgtattgccttgtggaaagctggttttgattacgcc
catggcacgggtcatggcgttggatcttacctatctgttcatgaaggaccacaaaatctt
tcgcgtaatggcagccaagaactgatcccaggaatgattctttctaatgaacctgggtat
taccgcgaaggagcttttggcattcgtattgaaaatttaatgattgtaaagccagcacaa
aaaattaacggtggggatatagaaatgctttcgtttgaaacactcaccaattgtcctatt
gattgccggttaattctcccagagcttttgacaccacaagagcgacaatggcttaatgat
tatcatgctcacgtttatcacattaatgcatcttacttaaatgaagacgacaaaaaatgg
gcaaaaaaagcgacaatgcccctttaa

DBGET integrated database retrieval system