KEGG   Bartonella quintana RM-11: RM11_0831Help
Entry
RM11_0831         CDS       T02294                                 

Definition
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
bqr  Bartonella quintana RM-11
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RM11_0831
   03410 Base excision repair
    RM11_0831
   03420 Nucleotide excision repair
    RM11_0831
   03430 Mismatch repair
    RM11_0831
Enzymes [BR:bqr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     RM11_0831
DNA replication proteins [BR:bqr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     RM11_0831
DNA repair and recombination proteins [BR:bqr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     RM11_0831
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     RM11_0831
   MMR (mismatch exicision repair)
    DNA ligase
     RM11_0831
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RM11_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(1033132..1035291)
Genome map
AA seq 719 aa AA seqDB search
MNKDEIKNLTALKAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFP
ELIRSDSPSHKIGAPVSEKFEKSVHAQAMLSLDNAFSSEDICEFIVRIRRFLRLPATQIL
EMTAEPKIDGLSLSLRYEKGRLVCAATRGDGYIGENVTANARTISDIPKVLRGEFPDIIE
VRGEVYMRRENFQVLNMSQQEKGKFVFANPRNAAAGSLRQLDPRITASRKLHFFAYACGE
VSETFAASQMEMMKKLKEYGFVINPLTKSFKTLEEIISYYHDIEECRHSLSYDIDGIVYK
VNDLKLQMRLGFVSRSPRWAVAHKFPAEKAIALLEGIDIQVGRTGALTPVARLAPITIGG
VVVTNASLHNEDYIKGIGHKGESIREGRDIRVGDTVIVQRAGDVIPQIVDIIAEKRPKGA
SAFVFPHLCPACGSHAVREVGESVRRCTGGLICPAQAIERIRHFVSRNAFDIEGLGKKQV
EFFFHIQDEALCIHTPADIFTLQRRQEKALVRLENMEGFGTVSVRKLYNAINMRRKVPLS
RFLFALGIRHIGEVNARRLAHAYQNYTAFETVAMAATMPYDKVGEEGNEAWLELINIEGI
GPQVGEAIIDFYQEAHNREVLAALLREVTPLDEENVMTTSSPIAGKTIVFTGTLARMSRD
EAKALAERLGAKTSGSLSKKTDLLVAGSAVGSKLAKAQGLGVEVIDEEAWLQLIEGSYI
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggatgaaattaaaaacttaactgctcttaaagcagaaagtgagctagagtgg
ttggcaaaagagattgcacgtcatgatgtactttataatcgtgatgaccaacctgaaatt
tctgatgcagagtatgatgctcttcgccggcgtaatgcagaaattgaagctctctttccc
gagcttattcgttcagattctccctcacataaaattggagcgccggtttctgaaaaattt
gaaaaatctgttcatgcccaggcaatgctttcacttgataatgcatttagctctgaagat
atctgtgaatttattgtacgtattcgtcgttttctacggcttccagcaacacaaatattg
gaaatgacagctgagccgaagatcgatggtttatctttgtctttgcgttatgaaaaagga
aggcttgtatgtgctgcaacccgtggtgatggatatataggtgaaaatgtcactgcgaat
gcacgaacaatttctgatattccaaaagttttgcgaggtgaatttcctgatattattgag
gttcgcggtgaagtttatatgcgacgggagaatttccaagtccttaatatgagccaacaa
gaaaagggcaaattcgtttttgctaatcctagaaatgcagcagctggttctttacgtcag
cttgatccacggataactgcaagcagaaagcttcatttttttgcttatgcatgtggtgaa
gtgagtgaaacatttgcagcaagccaaatggagatgatgaaaaagctaaaagaatatggc
tttgttatcaatccattaacaaaatcttttaagacactagaagagattatttcatattat
catgatattgaagaatgccgtcattccttaagttatgatattgatggaattgtttataaa
gttaatgatttgaagctacagatgcgtttggggtttgtttctcgttcaccacgttgggca
gttgcacataaatttccagcagaaaaagctatagcgcttttggaaggcattgatattcaa
gtcggtcgcacgggagcattaacgcctgttgcacgccttgcacctattactataggtggt
gtggtggttaccaatgcaagtttgcataatgaggattatattaagggaattggtcataaa
ggtgagtccattcgtgaagggcgtgatattcgcgtaggggatacagtaattgttcagcgc
gctggtgatgtgattcctcaaattgttgatattattgctgaaaagcgtccaaagggcgcc
tctgcttttgtttttcctcatctgtgtcctgcttgtgggagtcatgctgtgcgtgaagtg
ggagaatctgtgcgtcgatgcactggtgggcttatttgtccagcacaagcgattgagcgt
attcgtcattttgtttcgcgcaatgcctttgatattgaaggacttggtaaaaaacaagtg
gaattcttttttcatattcaagatgaggcgctttgtattcatacacccgctgatattttt
actttacaacgtcgccaagaaaaagctctggtacgtctggaaaatatggaaggttttggt
actgtttcagttcgtaaactttataatgccattaatatgcgtcgaaaagttcctttaagc
cgttttttatttgcattgggaattcgccatattggggaagttaatgcacggcgtcttgca
catgcttaccagaattatacagcgtttgagactgtagcgatggcagctaccatgccatat
gataaggtcggtgaagaaggcaatgaagcttggttggaacttattaatatcgaagggatt
ggaccacaggtaggtgaagcaattattgatttttatcaagaagcgcataaccgcgaagtt
ttggctgctttgcttcgagaagtaacacctcttgatgaagaaaatgtcatgacaacttct
tcgccaatagcaggaaagaccatcgtttttacaggcactttggcgcgtatgtcacgcgat
gaagcaaaagcgctagctgaacggttaggtgcaaagacttctggttctctttctaaaaaa
accgatcttcttgttgcaggatctgcagtgggatcaaaattggctaaagcacaagggtta
ggtgttgaggttatcgatgaagaggcttggttgcaattgattgagggatcttatatttag

DBGET integrated database retrieval system