KEGG   Bartonella quintana RM-11: RM11_0833Help
Entry
RM11_0833         CDS       T02294                                 

Definition
(GenBank) competence lipoprotein comL precursor
  KO
K05807  
outer membrane protein assembly factor BamD
Organism
bqr  Bartonella quintana RM-11
Brite
Transporters [BR:bqr02000]
 Other Transporters
  Pores ion channels [TC:1]
   RM11_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(1037090..1037917)
Genome map
AA seq 275 aa AA seqDB search
MGVVLLGSTCVLGGCLFKEKNTLDPSAYVLKMDPPDVLYNQALANLDSGRLGEASKKFLT
IEKQYAYTEWGRKSLVMGAFTNYQLAKYDEAISMAQRYITLYPGSDDSAYAYYIIGLSSF
CRIPDVTRDQRDTKRAIAAMQLLVERYPDSEYVKDAKAKIRIGREQLAGKEMQVGRYYEE
GQRYLAASRRFRKVVEEYSDTNQIEEALFRLTEVNLALGLTAEAQTAAAILGRNYPKSEW
YKFSYNLLKRNSISPQEHKSSWISRALNGDKNKVR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgtggtgcttttggggagcacctgtgtgttagggggatgcttatttaaagaaaaa
aatacccttgatccatctgcatatgttttaaaaatggatccaccagatgttctctataat
caggcacttgctaatcttgatagtgggcgacttggggaggcatcgaaaaagtttcttacg
attgaaaagcaatatgcttacactgaatggggacgtaaatctttagtgatgggtgctttt
acaaattaccaactcgccaaatatgatgaagcaattagcatggctcagcgctacattact
ctttatccagggtcagatgattcggcttatgcttattacattattggtctttcttctttc
tgtcggattcctgatgttacacgtgatcaacgcgataccaaacgtgctattgctgctatg
cagcttcttgtggagcgctatccggattctgagtatgtcaaggatgctaaagctaaaata
cgtattgggcgggagcagttagctggtaaagagatgcaggttggccgttattatgaggaa
ggtcagcgctatcttgctgcaagtagaagatttcgtaaagtggttgaagagtactccgat
acaaatcaaattgaagaagcgcttttccgcttgacggaggttaatcttgctcttggctta
accgcggaagcgcagaccgcagcagctattttaggacgtaattatcccaaaagtgagtgg
tataaattttcttacaatttgctaaagagaaatagtatatctccacaggagcataaatct
tcgtggatatcacgtgctttgaatggtgataagaataaggtacgttaa

DBGET integrated database retrieval system