KEGG   Bartonella quintana RM-11: RM11_0837Help
Entry
RM11_0837         CDS       T02294                                 

Definition
(GenBank) cell division protein ftsQ
  KO
K03589  
cell division protein FtsQ
Organism
bqr  Bartonella quintana RM-11
Brite
Chromosome [BR:bqr03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    RM11_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(1042382..1043281)
Genome map
AA seq 299 aa AA seqDB search
MNVDKTNVLQVLSVPVFPRLYRRFLRFMFEFVFTSVYVPRHFGSFAVLFFFLITVLYGFS
SNGRMGMIAKTAVSDIGFVVTDIDMSGNKRVVQQEILRILGLDAAPSIFTFDVDRARSLL
EQQAWIQLANVQKIYPNLVRISVVEREPYAIWQHDGMMDIVDSTGRVIVPFQRGVVQGLP
LVVGQGAQNAAKDFIQALSKYPQLFDHVRAYVRVGDRRWDLILDNGMRVMLPEKGVFERL
NSFIESGIVQDLFSRDVLRVDLRLSDRITVSLSDEALERHRAAVVAEKRVLNTRKAGNL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgttgataaaacaaatgttcttcaggtgctttcagtgccggttttcccacgtctt
tatcgtcgctttctccggtttatgtttgagtttgtatttaccagtgtttatgtgcctcgc
catttcggttcttttgcggttttattttttttcttgattacggtgctttacgggttttca
tcaaatggtcgtatgggaatgattgcgaagactgcagtatcggatattggttttgtggtt
accgatatcgatatgagtggcaataagcgcgtggtgcaacaggaaattttgagaatttta
gggcttgatgctgccccatctatattcacttttgatgttgatagagcgcggtctcttttg
gagcagcaggcttggattcaattggcgaatgttcagaagatttatcccaaccttgtgcgt
atttcagttgtggagcgtgagccgtatgcaatttggcagcatgatggcatgatggatatt
gtcgacagtacaggccgcgtcattgtgccctttcaaaggggggtagttcagggtttgcct
ctcgtggttggtcagggtgcacaaaatgctgccaaagactttattcaggccctttctaaa
tatccgcagttatttgatcatgtgcgcgcttatgttcgtgtaggtgatcggcgttgggat
ctgatcttagataatgggatgcgcgttatgttgcctgaaaagggtgtctttgaaaggctt
aattcttttattgagtcaggtatagtgcaagatcttttttctcgtgatgttttacgtgtt
gatttacgtctttctgatcgtattacagtttctttgtctgatgaagcattagaacgtcat
cgtgctgctgtggtggcagaaaaacgtgttttaaacacgcgaaaggcaggaaatttatga

DBGET integrated database retrieval system