KEGG   Bartonella quintana RM-11: RM11_0839Help
Entry
RM11_0839         CDS       T02294                                 

Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  
UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
bqr  Bartonella quintana RM-11
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RM11_0839
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RM11_0839
Enzymes [BR:bqr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     RM11_0839
Peptidoglycan biosynthesis and degradation proteins [BR:bqr01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   RM11_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1044449..1045402)
Genome map
AA seq 317 aa AA seqDB search
MIDGEALLAQLQPALGDIKGKLTPNVDMRKVTWFRTGGLAELFYQPADEADLALFLKTLP
EFISVTIVGIGSNLLVRDGGIPGVVIRLSAKGFGQVQQVSPKRFLVGAATAGKHLAAAAL
EAEITGFHFYHGIPGGLGGALKMNAGANGIETAARVVEVYALDRKGRHHILSLADMHYSY
RHCAIPKDFIFTAALLEGEPGNRDDIRAAMDEVALHRETVQPVREKTGGSTFRNPENISA
WRVIDEAGCRGLQIGGAQMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWE
IQRIGQFEQSRIVPSFG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatggtgaagcgctgttggcgcaattgcaaccggcgttaggcgatataaagggc
aagcttacgcctaatgttgatatgcggaaggtaacgtggtttcgcactggtggtttggct
gagcttttttatcagcctgctgatgaggcagatttagctctctttcttaaaactttgcct
gaatttatttctgtaacaattgtgggaattggttctaatcttctggtacgtgatggtggg
attcctggagttgttattcgtctttcagcaaaaggttttgggcaagtgcagcaggtttct
ccaaagcgctttctggttggtgctgctacggcgggtaaacatttagcagcggcagctttg
gaggccgagattacaggttttcatttttatcatggtattcctggtggtcttggaggagca
ttaaaaatgaatgcaggggctaatggtattgaaacagctgcgcgtgttgttgaggtctac
gcccttgatcgtaaagggcggcatcatatcttgagtttggcagatatgcattattcttat
cgtcattgtgctatccctaaagatttcatttttactgctgctttgttagaaggcgagcca
ggaaatagagacgatattcgtgcggctatggatgaagttgctcttcatcgggaaacagta
caacctgttcgtgaaaagaccggtgggtcaacattccgaaatcctgaaaatatctctgcg
tggcgcgttattgatgaggcaggatgccgtggtttgcagattggtggagctcaaatgagt
gaaatgcactgtaattttatgattaatacagggcaagcaacaggttatgatcttgaagca
ttgggagaaacagtgcgtgctcgtgtttttgctcattcggctcacctattacagtgggaa
atacagcgtatcggtcaatttgaacaaagccgtattgttccttcttttggctag

DBGET integrated database retrieval system