KEGG   Bartonella quintana RM-11: RM11_0840Help
Entry
RM11_0840         CDS       T02294                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  
UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
bqr  Bartonella quintana RM-11
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RM11_0840
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RM11_0840
Enzymes [BR:bqr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     RM11_0840
Peptidoglycan biosynthesis and degradation proteins [BR:bqr01011]
 Precursor biosynthesis
  Amino acid ligase
   RM11_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
complement(1045395..1046765)
Genome map
AA seq 456 aa AA seqDB search
MSGIAEVLHNLGYKVQGSDHVDSANVERLRGKGINIQIGHHAENLGDAEVVVLSTAIKKT
NPEYIAAKEKHLPIVRRAEMLAELMRFRRAIAVGGTHGKTTTTSMIAALLDAGRFDPMVI
NGGIINAYGTNARMGSGDWMVVEADESDGTFLKLPADIAVVTNIDREHLDHYGSFCAVRE
AFRKFVENVPFYGFAVLCLDHPEVQSLASRIDDRWVITYGTNPQADIRFLNLSMDGQKTH
FDVFIRSRKTGKETELKNLVLPMSGQHNVSNATAAIAIAHELGISNESIKKGLAEFGGVK
RRFTQTGSWRGIEIFDDYGHHPVEIKAVLYAARESAKGRVIAIVQPHRYSRLYHLFDDFA
ACFNDADTVLIAPIYGAGEAPIAGFGARELVEHIKMAGHRDVRLIHCLEDVVLIVSTFAK
PDDYVVFLGAGNITQWAAALPHQLAVLDNNDEFSVD
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaattgcggaggttttgcataatcttggctataaagttcaaggatctgatcac
gttgatagtgcaaatgttgaacgtttacggggaaaaggaattaacattcagataggtcat
catgctgaaaatttaggggatgcagaggttgttgttctttctactgctattaaaaaaaca
aatcctgaatatattgctgcgaaagaaaagcatttgccgattgtgagacgtgctgaaatg
cttgctgagctgatgcgttttcgtcgggcaattgcagtcggtggtacacatggcaaaaca
acaactacatcaatgatagcagcgcttcttgatgctggtcgttttgatccgatggtgatt
aatggtggtattatcaatgcttacggtacgaacgctcgtatggggagtggcgattggatg
gtggttgaggccgatgaaagtgatggtacttttttaaagttgcctgcggatattgctgtt
gttaccaatatcgaccgtgagcatttagaccattatgggagtttttgtgctgtgcgtgag
gcttttcggaaatttgtagagaatgttcctttttatggttttgctgttttgtgccttgat
cacccagaggttcagtctttggctagtcgtattgatgatcgttgggtgatcacctatggc
acaaatccacaagctgatattcgttttcttaatctttctatggatggtcaaaaaacgcat
tttgacgttttcattcgttcgcggaaaacaggtaaagagactgaattgaaaaatttggtt
ttgccaatgtctggtcagcacaatgtttcgaacgcaactgcggcgattgctattgctcat
gaacttggcatttcaaatgaatctataaaaaagggcttagcagaatttggtggagtaaaa
cggcgttttacgcaaacaggaagttggcgtggcattgaaatatttgatgattatggacat
catcctgttgaaataaaggctgttttatatgcagcacgtgagagtgcaaaagggcgcgtg
attgcgattgtgcaaccccatcgttattcacgtttgtaccatttgtttgatgattttgct
gcttgttttaatgatgcagatacagtgttgattgcaccgatttatggagctggtgaagca
ccaatcgctggttttggtgctagagaattggtagagcatattaaaatggctggtcatcgt
gatgtacgcttgattcattgtttggaagatgttgttttaattgtttctacatttgctaag
cctgatgattatgttgtttttctcggtgctggcaatatcacacaatgggctgctgctttg
cctcaccagttggcggtacttgataacaatgatgaattttcagttgattga

DBGET integrated database retrieval system