KEGG   Bartonella quintana RM-11: RM11_0855Help
Entry
RM11_0855         CDS       T02294                                 

Definition
pyrazinamidase/nicotinamidase pnca
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bqr  Bartonella quintana RM-11
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bqr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065784..1066398
Genome map
AA seq 204 aa AA seqDB search
MLMEKKALIVIDVQNDFLPGGALAVPQGDTILPVVNNFIDYFDHIILTQDWHPKNHCSFA
SSYPEKTPYDTVKLDYGPQILWPDHCIQGTQGAEFHTSLKVEKAQLILRKGYNQKIDSYS
AFFENDQKTPTGLQVYLKEHGFTKLIMCGLATDFCVGFSALHAIQCGFKVSVSLNACAGI
DLNGSLNTMLKTMNEAGIELLITS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggaaaaaaaagccttaatcgttattgacgtccaaaatgacttcttaccaggt
ggagcacttgcagtaccacaaggtgatacgattttacctgttgttaataatttcatagac
tattttgatcatatcattttaacccaagactggcatcccaaaaaccattgcagctttgct
tcttcctaccctgaaaaaacgccttatgatactgtcaaacttgactatggtcctcaaata
ctctggcctgatcattgtatacaaggaacacaaggagcagaatttcacacatctctcaaa
gttgagaaagcacagctcatcctcagaaaaggctataatcaaaaaattgatagctattct
gctttttttgaaaatgatcaaaaaacaccaacaggcttacaagtttaccttaaagaacat
ggttttacaaaactcattatgtgtggcttagcaacggatttttgtgttggattttctgca
cttcatgccatacaatgcggctttaaagtcagcgtttcattaaatgcctgtgctggtatt
gatttaaatggatcgcttaatacgatgcttaaaactatgaatgaagccggtatagaactc
ttaataacctcctaa

DBGET integrated database retrieval system