KEGG   Bartonella quintana RM-11: RM11_1050Help
Entry
RM11_1050         CDS       T02294                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bqr  Bartonella quintana RM-11
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RM11_1050
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RM11_1050
Enzymes [BR:bqr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     RM11_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347754..1349049
Genome map
AA seq 431 aa AA seqDB search
MDSIQIVGGKKLKGTIPISGAKNAALPLMIAALLTEETVTLDNIPHLADVELLIRILNNH
GVGYAVDGQKPHHDCTDSRTIHFTAQKITTTYAPYELVRKMRASFWVIGPLLARCHEAYV
SLPGGCAIGTRPVNFILEGLKTLGARIAIENGYVHAKAPKGLKGAHYHFPKVTVGGTHVM
LMAAATANGTTLLENAACEPEVTNLIQALNAMGAKITGEGTSTLTIEGVKKLHGARISVI
ADRIEAGTYAMVVAMTGGNVLLKNANPHHLTQVLEVLQKTGLDIEIKPQGLHLKRNPRQT
KIMPVNIKTGPYPAFPTDLQAQFMALMTRAQGTACITETIFENRFMHVQELTRLGAQIKL
DGQTATVYGREHLQGAPVMATDLRASVSLVIAALAAKGESVINRVYHLDRGFERLEEKLA
RCGAIIQRITV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggattctattcaaattgttggtgggaaaaaacttaaaggcactattcctatttcaggg
gcaaaaaatgctgccttgcctctgatgatcgcagctttgctcaccgaagaaactgtcact
ttagacaatatcccccatcttgctgatgttgaactgttaatccgcatacttaacaatcac
ggtgtcggctatgccgtcgacggacaaaaaccccaccacgattgtactgattcaagaaca
atccattttaccgcacaaaaaataaccacaacatacgcaccatacgaacttgtgcgaaaa
atgcgggcaagtttttgggtaatcgggccactgcttgcacggtgtcacgaggcttatgtt
tccctccccggaggatgcgctatcggaactagacccgtcaattttattctcgaagggctt
aaaactctaggagctcgtattgctatcgaaaatggatatgtccatgctaaagcgccaaaa
ggattaaaaggcgcacactatcattttcctaaagtcactgttggtggaacacatgttatg
ctcatggcggcagcaactgcaaacggaacaactctccttgaaaatgctgcttgtgaacca
gaagtgaccaatcttatccaagcccttaacgccatgggtgcaaaaataacgggtgaagga
acatcaaccctcaccatcgagggtgtcaaaaaacttcatggagcaagaatatctgtcatc
gctgaccgaatagaagccggaacctatgccatggttgttgctatgaccggtggcaatgta
ttgctcaaaaatgctaacccgcaccatcttacgcaagtgctcgaggtcctccaaaaaacc
gggcttgatattgagataaaaccgcaaggactgcacctcaaacgaaatccacggcaaaca
aaaataatgcccgtcaatataaaaacagggccttatcccgcttttccaactgatctccaa
gcgcaattcatggcactgatgacacgcgctcaaggaactgcttgtattactgaaacgatt
ttcgaaaatcgcttcatgcatgttcaggaactcacccgtttaggcgctcaaataaagctt
gatgggcagacagcaaccgtctacggaagagaacatctgcaaggtgccccagtgatggct
accgatttgcgtgcttccgtttctcttgttattgctgcactggcggcgaaaggagaaagc
gtcatcaaccgcgtgtatcaccttgatcgcggctttgaaaggttggaagaaaaattagcc
cggtgtggggctatcattcaacgcataacagtctaa

DBGET integrated database retrieval system