KEGG   Bartonella quintana Toulouse: BQ01640Help
Entry
BQ01640           CDS       T00181                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bqu  Bartonella quintana Toulouse
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BQ01640 (galU)
   00052 Galactose metabolism
    BQ01640 (galU)
   00500 Starch and sucrose metabolism
    BQ01640 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BQ01640 (galU)
Enzymes [BR:bqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BQ01640 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214238..215128
Genome map
AA seq 296 aa AA seqDB search
MRKIRKAVFPVAGLGTRFLPATKTIPKEMLTVVDKPVIQYVVDEAREAGIEHFIFVTGRN
KVVLEDYFDVQVELYTILAERGKREELEHLHGLQPPPGTTSFTRQQQPLGLGHALWCARE
LVEGEPFALLLPDMLMQAKKGCLSEMINLYEKIGGGNIIAVQECDPAQAHKYGIVGKGKQ
IANGFEITKMVEKPTKGTAPSNLYINGRYILQPEIFNILSNQERGAENEIQLTDAMMRLS
NEQDFFGFQLEGRTFDCGSKAGFIEANVAFSLARADMHSQISASLKDLLETIKVGK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaattcggaaagcagtatttcctgtagctggtcttggtacacgttttcttcct
gcaacaaaaacaattcctaaagaaatgctaactgttgttgataagcccgttattcaatat
gttgtagatgaagcacgtgaagctggtattgaacattttatttttgttactgggcgtaat
aaagtagtccttgaggattattttgatgtgcaagttgagttatatacaatccttgccgaa
cgtggcaaaagagaagaacttgagcatttacacggtttacagcctccaccagggacgact
tcttttacgcggcaacagcaacctttggggctaggacatgctctttggtgcgcacgtgaa
ttagttgagggggaaccttttgctttgttgttacccgatatgctgatgcaagctaaaaag
gggtgcctttctgagatgattaatctttatgagaaaatcggtggtggcaatattatcgcc
gttcaggagtgcgatcctgcacaagcgcataaatatggtattgttggaaaaggcaaacag
attgcaaatggttttgaaatcacaaaaatggtagaaaaaccaacaaaaggaacagctcca
tcgaatttgtacatcaatggacgttatatcttgcaaccagaaatttttaatattctctcc
aatcaagaacgaggagcagaaaacgaaattcagttaacagatgcaatgatgcggctttca
aacgagcaagatttctttggcttccagttagaggggcgcacttttgattgtggttcaaaa
gccggttttattgaagccaatgttgcattttctttagcacgcgctgatatgcatagccaa
atttctgcttcattgaaagatttactagaaaccattaaagtgggaaaatga

DBGET integrated database retrieval system