KEGG   Bartonella quintana Toulouse: BQ02180Help
Entry
BQ02180           CDS       T00181                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BQ02180 (recR)
DNA repair and recombination proteins [BR:bqu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BQ02180 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BQ02180 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: CAF25721
UniProt: Q6G0M8
Position
complement(278538..279143)
Genome map
AA seq 201 aa AA seqDB search
MSKHIAGPEIERLIQLLARIPGFGPRSARRAALYLIKKKETLLEPLGAAIQAAVDKVCIC
SVCGNVDTTDPCSICRDPRRDDTTIIVVEDVADLWALERARTLAARYHVLGGRLSPLDGI
GPDELNITSLVQRVVQNPIMEIILAVNATVEGQTTAHYITDQLSNFSVKITRLAHGVPVG
GELDYLDDGTLAAALQARTNL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcacattgcaggacctgagattgagcgcctcattcagcttttagcgcggata
ccaggttttggtccgcgttcagcgcgtcgtgctgcactttaccttatcaaaaaaaaggag
acattgctggagcccttaggagcagctatacaagcagctgtagataaagtctgcatttgt
tctgtttgtggaaatgtcgataccactgatccttgttcgatttgtagagatcctcgccgc
gatgatacaacaattattgttgttgaagatgttgctgatctctgggctcttgagcgtgcg
agaactttagcagcccgttatcatgtcttaggcggacggctctcaccattagatggaata
ggacctgatgaactcaacatcacctccttagttcagcgcgttgtacagaatccaattatg
gagattattctagctgttaatgctacggttgaaggacaaacaacagctcactacatcacg
gatcagctctccaatttttcagttaaaattacgcgacttgcccatggagtacccgtagga
ggtgaactagattatcttgatgatggaaccttggctgcagccttacaggcaagaacaaat
ctttaa

DBGET integrated database retrieval system