KEGG   Bartonella quintana Toulouse: BQ02240Help
Entry
BQ02240           CDS       T00181                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bqu  Bartonella quintana Toulouse
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BQ02240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BQ02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285276..285815
Genome map
AA seq 179 aa AA seqDB search
MNRSTVAYFICACLFLLIILVGISTLSNMVYDHSASVQPAYKVTKSDVLKKKQLTSDISL
SLNDRLQQGNLENGRKIFRQCALCHTSGQNEVGRVGPALWGVVDRPLAATTGFAYSRVLR
ANSDKRWDFVTLDRYLQSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSDHPVSLPMR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttcgacagttgcctattttatttgtgcttgtctatttttgctgattattttg
gtgggaatttctacactcagcaacatggtttatgatcattctgcatcggttcaacctgct
tataaggttacaaaaagtgatgtgctcaagaaaaaacagctgacatctgatatttcttta
tcattgaacgatcgtcttcaacaaggaaatcttgaaaatgggcgtaagatttttcgtcag
tgtgctctatgccatacctcgggacagaatgaagttggccgtgttggtccagcactttgg
ggggtagttgaccgtcctttggcggctacaacaggttttgcttattcacgtgtattgcgt
gcaaattctgataagagatgggattttgtgactttggatcgttatctgcaatctccacgt
gaagcgtttccaggaacaattatgtcttttcgtgggattaaaaatgatcaagatcgtgct
gatcttttgctttatttacgcagtttgtccgatcatcctgtttctttgccgatgcgataa

DBGET integrated database retrieval system