KEGG   Bartonella quintana Toulouse: BQ02370Help
Entry
BQ02370           CDS       T00181                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bqu  Bartonella quintana Toulouse
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bqu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299957..300832
Genome map
AA seq 291 aa AA seqDB search
MPELPEVETVRRGLEPVITGAKIISITLNRRDLRFPFPEAFSERLVGRTIMELGRRGKYL
LFHLSQNETILSHLGMSGSWRIEDDLLRKTYSAAGKFVKHDHFLMDIQAKDGKVYHLTYN
DVRRFGFMLLLDTNRIYEHPLLKKLGLEPLSNEFSGRYLQEAFVNKKISLKGVLLDQSII
AGLGNIYVCEALWRSRLSPQRGAFTLALKTVCAREFADSLAQNIRNVIAEAISFGGSTLR
DYIRTDGSLGYFQHSFSVYGREGKECFQCGIPITRISQSGRSSFYCSQCQK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactccctgaagtagaaacagttcgtcgtggacttgagccggttataactggt
gcaaagattatatcaatcacgcttaatcgtagagatttacgatttcctttccctgaggcc
ttttctgagaggcttgtgggcagaacaattatggaacttggtcgacgcgggaaatatttg
ttatttcatctttcgcaaaatgaaacaattttgagtcatttaggaatgtcgggatcatgg
cgtatagaggatgatcttttaagaaaaacatattctgctgcagggaaatttgttaagcat
gaccactttctcatggatattcaagcaaaggatggtaaagtttatcatcttacttataat
gatgttcgtcgttttgggtttatgcttttactagatacaaacaggatttatgagcatccg
cttttaaagaaactagggctcgagcctctgagcaatgagttttctggtcgttatttacaa
gaagcttttgttaataaaaaaatatctctcaaaggagtcttacttgatcagtctattatt
gcaggtcttgggaatatttatgtttgcgaagcgctttggcgtagtcgcttgtctccacaa
cgtggagcattcaccttagcattgaagactgtatgtgcacgcgaatttgcagattcttta
gcgcagaatatacgcaatgtgattgctgaagcaatttcttttggtggatctactttacgg
gattatattcgtacagatggctcacttggttattttcaacactctttttcagtttatgga
cgagaaggcaaagaatgctttcaatgtggaatacctattacacgtatttcacagtctgga
cgttcaagcttttactgttcacagtgtcaaaaataa

DBGET integrated database retrieval system