KEGG   Bartonella quintana Toulouse: BQ03230Help
Entry
BQ03230           CDS       T00181                                 

Gene name
thrB
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bqu  Bartonella quintana Toulouse
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BQ03230 (thrB)
Enzymes [BR:bqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BQ03230 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
401900..402808
Genome map
AA seq 302 aa AA seqDB search
MMSDVKVSFKGHSYVFTPIKLNLTLHVVGQRTDGYHLIESLVYFSFSGDCLSYMPCKSNH
FILTGPFADELVSDTGNLVVRAHDFMCKAFPKCAKPAFFRLVKLLPVASGIGGGSGNAAG
VLSLLRQQWGLDCSCEKLAEMSLVLGADVPMCLFALEYRQPLFVRGIGQDITQLKEACSL
AMVLVNHGQQIATKAVFKALEKRDHPPLKIDLESLKTVDSLVEALQETRNDLFIPALKIA
PQLSEVLYALDESGALFSRMSGTGATCFGIFKDKEAAQQAALFIKLMHPDWFVKPIITLG
ML
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggatgtaaaagtttcgttcaaagggcattcttacgtatttacacctattaag
ttgaacttaaccttgcatgttgtagggcagcgcacggatggttatcatttaatagaaagt
ttggtttattttagtttcagcggtgattgtttgagctatatgccttgtaagagtaaccac
tttattttaacagggccttttgccgatgagcttgtttctgatacaggtaatttggttgtt
cgtgcacatgactttatgtgtaaggcctttcctaagtgtgccaaacctgctttttttcga
cttgttaaactattgccggttgcttcggggattggtggtggttcgggcaatgctgctggt
gttttgagtctattgcgtcagcagtggggtcttgattgctcttgtgaaaaattggcggaa
atgagcttagtgcttggcgctgatgtgccgatgtgtctttttgcattggagtatcggcag
ccactttttgttagaggaattgggcaagatataacacagttaaaagaggcttgttctctt
gcaatggttttggttaatcatggacaacagattgcgacgaaagctgtttttaaggctttg
gagaagcgcgatcatccacccttgaagattgatctagaatctctcaagacggttgattca
ttggttgaagctttacaagaaacacgtaacgatctttttattcccgcattaaaaattgca
cctcaactgtctgaagttttatatgccttagatgagagtggagctctcttttctcgtatg
tccgggactggtgcaacttgttttggtatttttaaagataaagaagcagcgcagcaggct
gcactttttatcaaattgatgcatccagattggtttgttaaacctatcataactttagga
atgctttag

DBGET integrated database retrieval system