KEGG   Bartonella quintana Toulouse: BQ04780Help
Entry
BQ04780           CDS       T00181                                 

Gene name
pcm1
Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bqu  Bartonella quintana Toulouse
Brite
Enzymes [BR:bqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BQ04780 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F Methyltransf_11 MTS RrnaAD Methyltransf_23 Methyltransf_4 GCD14 Methyltransf_3 NodS DREV
Motif
Other DBs
NCBI-ProteinID: CAF25977
UniProt: A0A0H3LTV9
Position
583846..584505
Genome map
AA seq 219 aa AA seqDB search
MNQKGILRFHEELAGLVLKMRSKGIDDVRFFAALEKVPRQQFVASPWCNSAYDNKVIPIE
CGEYIERLEEQLLILFALSLKKKHRILEIGTGSGFCTALMACLSERVITIDRYKTLIDLA
RQKFQTLGIENIVLRQVDGSRTVTGFGSFDRILIWPSRSDEPKEFLELLTENGILIQAIG
PDEGVQTITRYTKIGSRFECLEMFQVRYQPFIEGIAETL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaagggtattttacgatttcatgaggagttggccggtcttgtgctgaaaatg
cgcagcaaaggaattgatgatgttcgcttttttgcagcattggagaaagttccgcggcag
cagtttgtggcttctccttggtgtaacagcgcatatgataataaagttatcccaattgag
tgtggtgaatatattgagcgtttggaagagcagcttttgatcctttttgctttatcgttg
aaaaagaaacatcgcatcttagaaattggtacgggttctggtttttgtactgcccttatg
gcatgtcttagtgaacgtgtaataacaattgatcgctataaaacacttattgatttggcg
cgtcaaaaatttcaaactttgggaattgagaatattgttttacgacaggttgatggaagc
cgtactgttacaggttttggatcgtttgatcgtattcttatttggccatcacgctctgat
gaaccaaaggaatttttagaacttttaactgaaaatggcattctcattcaagccatagga
cccgatgaaggggtacaaacgattacgcgttatacaaaaattggtagccgatttgagtgc
ttagaaatgtttcaagtgcgctatcaaccctttattgaaggtattgcggaaacactttga

DBGET integrated database retrieval system